ER beta/ESR2 Protein, Human (His)

ER beta/ESR2 Protein, a nuclear hormone receptor, binds estrogens akin to ESR1/ER-alpha. It activates estrogen-dependent reporter genes with ERE. However, it lacks ligand binding ability and exhibits minimal ERE binding, resulting in the loss of ligand-dependent transactivation ability. ER beta/ESR2 Protein, Human (His) is the recombinant human-derived ER beta/ESR2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ER beta/ESR2 Protein, Human (His) is 323 a.a., with molecular weight of 35-40 kDa.

ER beta/ESR2, a nuclear hormone receptor, exhibits estrogen-binding capabilities comparable to those of ESR1/ER-alpha and, in turn, triggers the expression of reporter genes harboring estrogen response elements (ERE) in an estrogen-dependent fashion. However, it is noteworthy that ER beta/ESR2 lacks intrinsic ligand binding ability and displays either no or minimal ERE binding activity, resulting in the attenuation or loss of ligand-dependent transactivation capacity. This dual nature, where it can bind estrogens but lacks the typical ligand-dependent activation potential, underscores its distinct regulatory role and highlights its contribution to the intricate network of estrogen-mediated signaling pathways.

Human

E. coli

N-6*His

Q92731-3 (M1-A323)

2100  [NCBI]

MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA

35-40 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl, pH 8.0 or 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.