Copy Link Print Information

4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc)

Customer Review

Based on 1 Customer Validation

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8(+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for 4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc)
  • Experimental Validation Results for 4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc)
  • 4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8(+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

4-1BB/TNFRSF9 Protein, functioning as the receptor for TNFSF9/4-1BBL, plays a pivotal role in conveying signals that augment CD8(+) T-cell survival, cytotoxicity, and mitochondrial activity, thereby contributing to enhanced immunity against viruses and tumors. It predominantly exists as a homodimeric structure, with the possibility of monomeric states. The association with key signaling molecules, including p56-LCK and interactions with TRAF1, TRAF2, and TRAF3, underscores its importance in mediating intracellular pathways essential for promoting immune responses and regulatory functions.

In Vitro

4-1BB (hamster ovary; 5 μg/mL; 16 h) costimulates B lymphocyte proliferation[4].

Verified Bioactivity

Measured by its ability to block 4-1BBL-induced IL-2 secretion by mouse CTLL-2 cells. The ED50 for this effect is 0.603 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 1.66×10^3 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to block 4-1BBL-induced IL-2 secretion by mouse CTLL-2 cells. The ED50 for this effect is 0.603 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 1.66×103 U/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession

    P20334 (V24-L187)

  • Gene ID
    21942  [NCBI]
  • Molecular Construction
    • N-term
    • 4-1BB (V24-L187)
      Accession # P20334
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TNFRSF9; CDw137; Prev. ILA; Tumor Necrosis Factor Receptor Superfamily, Member 9; CD137; Induced By Lymphocyte Activation (ILA); 4-1BB; Homolog Of Mouse 4-1BB; Tumor Necrosis Factor Receptor Superfamily Member 9; Receptor Protein 4-1BB; T-Cell Antigen 4-1

  • AA Sequence

    VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

  • Predicted Molecular Mass

    43.7 kDa

  • Molecular Weight

    Approximately 59 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to block 4-1BBL-induced IL-2 secretion by mouse CTLL-2 cells. The ED50 for this effect is 0.603 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 1.66×103 U/mg.

  • 4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) Product Image
    1/16
  • Experimental Validation Results for 4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc)
  • Experimental Validation Results for 4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc)
  • 4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) Product Image