1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins
  4. TNF Receptor Superfamily 4-1BB/CD137
  5. 4-1BB
  6. 4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc)

4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc)

Cat. No.: HY-P7447A
COA Handling Instructions

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8(+) T cells, thereby promoting immunity against viruses and tumors. Mainly a homodimer, it can exist in a monomeric state. 4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of 4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is 164 a.a., with molecular weight of approximately 58.72 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $90 In-stock
50 μg $250 In-stock
100 μg $425 In-stock
500 μg $1190 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8(+) T cells, thereby promoting immunity against viruses and tumors. Mainly a homodimer, it can exist in a monomeric state. 4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of 4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is 164 a.a., with molecular weight of approximately 58.72 kDa.

Background

4-1BB/TNFRSF9 Protein, functioning as the receptor for TNFSF9/4-1BBL, plays a pivotal role in conveying signals that augment CD8(+) T-cell survival, cytotoxicity, and mitochondrial activity, thereby contributing to enhanced immunity against viruses and tumors. It predominantly exists as a homodimeric structure, with the possibility of monomeric states. The association with key signaling molecules, including p56-LCK and interactions with TRAF1, TRAF2, and TRAF3, underscores its importance in mediating intracellular pathways essential for promoting immune responses and regulatory functions.

Biological Activity

Measured by its ability to block 4-1BBL-induced IL-2 secretion by mouse CTLL-2 cells. The ED50 for this effect is 0.603 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 1.66×10^3 U/mg.

  • Measured by its ability to block 4-1BBL-induced IL-2 secretion by mouse CTLL-2 cells. The ED50 for this effect is 0.603 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 1.66×103 U/mg.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P20334 (V24-L187)

Gene ID

21942  [NCBI]

Molecular Construction
N-term
4-1BB (V24-L187)
Accession # P20334
hFc
C-term
Synonyms
rMu4-1BB/TNFRSF9, C-Fc; CD137; 4-1 BB; TNFRSF-9
AA Sequence

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Weight

approximately 58.72 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc)
Cat. No.:
HY-P7447A
Quantity:
MCE Japan Authorized Agent: