Amphiregulin Protein, Mouse (HEK293, Fc)

Amphiregulin Protein, an EGFR ligand, acts as an autocrine growth factor and mitogen for diverse cells, including astrocytes, Schwann cells, and fibroblasts. Engaging with CNIH in its immature stage, Amphiregulin's EGFR activation emphasizes its vital role in regulating cell growth and orchestrating various cellular functions across different cell types. Amphiregulin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Amphiregulin protein, expressed by HEK293 , with N-hFc labeled tag. The total length of Amphiregulin Protein, Mouse (HEK293, Fc) is 149 a.a., with molecular weight of 45-50 kDa.

Amphiregulin, a ligand for the EGF receptor (EGFR), functions as both an autocrine growth factor and a mitogen for a diverse array of target cells, such as astrocytes, Schwann cells, and fibroblasts. Its impact spans cellular proliferation, and during its immature precursor stage, Amphiregulin engages in interactions with CNIH. This versatile ligand's capacity to activate EGFR underscores its crucial role in regulating cell growth and underscores its significance in orchestrating various cellular functions across different cell types.

Measured in a cell proliferation assay using Balb/3T3 cells. The ED₅₀ for this effect is 19.54 ng/mL, corresponding to a specific activity is 5.11×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using Balb/3T3 cells. The ED₅₀ for this effect is 19.54 ng/mL, corresponding to a specific activity is 5.11×10⁴ units/mg.

Mouse

HEK293

N-hFc

P31955 (V100-A248)

11839  [NCBI]

VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHLWKRYFREYEGETEERRRLRQENGTVHAIA

45-50 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.