1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Amphiregulin
  5. Amphiregulin Protein, Mouse (HEK293, Fc)

Amphiregulin Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P77868
COA Handling Instructions

Amphiregulin Protein, an EGFR ligand, acts as an autocrine growth factor and mitogen for diverse cells, including astrocytes, Schwann cells, and fibroblasts. Engaging with CNIH in its immature stage, Amphiregulin's EGFR activation emphasizes its vital role in regulating cell growth and orchestrating various cellular functions across different cell types. Amphiregulin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Amphiregulin protein, expressed by HEK293 , with N-hFc labeled tag. The total length of Amphiregulin Protein, Mouse (HEK293, Fc) is 149 a.a., with molecular weight of 45-50 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $240 In-stock
50 μg $395 In-stock
100 μg $668 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Amphiregulin Protein, Mouse (HEK293, Fc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Amphiregulin Protein, an EGFR ligand, acts as an autocrine growth factor and mitogen for diverse cells, including astrocytes, Schwann cells, and fibroblasts. Engaging with CNIH in its immature stage, Amphiregulin's EGFR activation emphasizes its vital role in regulating cell growth and orchestrating various cellular functions across different cell types. Amphiregulin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Amphiregulin protein, expressed by HEK293 , with N-hFc labeled tag. The total length of Amphiregulin Protein, Mouse (HEK293, Fc) is 149 a.a., with molecular weight of 45-50 kDa.

Background

Amphiregulin, a ligand for the EGF receptor (EGFR), functions as both an autocrine growth factor and a mitogen for a diverse array of target cells, such as astrocytes, Schwann cells, and fibroblasts. Its impact spans cellular proliferation, and during its immature precursor stage, Amphiregulin engages in interactions with CNIH. This versatile ligand's capacity to activate EGFR underscores its crucial role in regulating cell growth and underscores its significance in orchestrating various cellular functions across different cell types.

Biological Activity

Measured in a cell proliferation assay using Balb/3T3 cells. The ED50 for this effect is 19.54 ng/mL, corresponding to a specific activity is 5.11×104 units/mg.

  • Measured in a cell proliferation assay using Balb/3T3 cells. The ED50 for this effect is 19.54 ng/mL, corresponding to a specific activity is 5.11×104 units/mg.
Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

P31955 (V100-A248)

Gene ID
Molecular Construction
N-term
hFc
Amphiregulin (V100-A248)
Accession # P31955
C-term
Synonyms
Amphiregulin; AR; SDGF; AREG; AREGB; CRDGF; MGC13647
AA Sequence

VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHLWKRYFREYEGETEERRRLRQENGTVHAIA

Molecular Weight

45-50 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Amphiregulin Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Amphiregulin Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77868
Quantity:
MCE Japan Authorized Agent: