Animal-Free MCP-1/CCL2 Protein, Pig (His)

MCP-1/CCL2 protein acts as a ligand for CCR2, inducing chemotactic responses and calcium mobilization. It attracts monocytes and basophils but not neutrophils or eosinophils. Animal-Free MCP-1/CCL2 Protein, Pig (His) is the recombinant pig-derived animal-Free MCP-1/CCL2 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

CCL2 protein functions as a ligand for C-C chemokine receptor CCR2, initiating a potent chemotactic response and intracellular calcium mobilization through the binding and activation of CCR2. It exhibits chemotactic activity for monocytes and basophils while remaining inactive towards neutrophils or eosinophils. Playing a crucial role in mediating neuropathic pain induced by peripheral nerve injury, CCL2 also enhances NMDA-mediated synaptic transmission in dopamine D1 and D2 receptor-containing neurons, possibly involving MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B. Existing as a monomer or homodimer in equilibrium, it is tethered to endothelial cells by glycosaminoglycan (GAG) side chains of proteoglycans and interacts with TNFAIP6 through its Link domain.

Pig

E. coli

N-6*His

P42831 (Q24-P99)

397422  [NCBI]

Full Length of Mature Protein

QPDAINSPVTCCYTLTSKKISMQRLMSYRRVTSSKCPKEAVIFKTIAGKEICAEPKQKWVQDSISHLDKKNQTPKP

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.