Animal-Free MCP-1/CCL2 Protein, Pig (His)
Based on 1 Customer Validation
MCP-1/CCL2 protein acts as a ligand for CCR2, inducing chemotactic responses and calcium mobilization. It attracts monocytes and basophils but not neutrophils or eosinophils. Animal-Free MCP-1/CCL2 Protein, Pig (His) is the recombinant pig-derived animal-Free MCP-1/CCL2 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.
- Species: Pig
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MCP-1/CCL2 protein acts as a ligand for CCR2, inducing chemotactic responses and calcium mobilization. It attracts monocytes and basophils but not neutrophils or eosinophils. Animal-Free MCP-1/CCL2 Protein, Pig (His) is the recombinant pig-derived animal-Free MCP-1/CCL2 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.
Background
CCL2 protein functions as a ligand for C-C chemokine receptor CCR2, initiating a potent chemotactic response and intracellular calcium mobilization through the binding and activation of CCR2. It exhibits chemotactic activity for monocytes and basophils while remaining inactive towards neutrophils or eosinophils. Playing a crucial role in mediating neuropathic pain induced by peripheral nerve injury, CCL2 also enhances NMDA-mediated synaptic transmission in dopamine D1 and D2 receptor-containing neurons, possibly involving MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B. Existing as a monomer or homodimer in equilibrium, it is tethered to endothelial cells by glycosaminoglycan (GAG) side chains of proteoglycans and interacts with TNFAIP6 through its Link domain.
Technical Parameters
-
Species Pig
-
Source E. coli
-
Tag N-6*His
-
Accession
P42831 (Q24-P99)
-
Molecular Construction
-
N-term
-
6*His
-
CCL2 (Q24-P99)
Accession # P42831 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL2; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 2; Prev. SCYA2; Chemokine (C-C Motif) Ligand 2; MCP-1; Monocyte Chemotactic Protein 1; MCP1; Small-Inducible Cytokine A2; MCAF; C-C Motif Chemokine 2; HC11; MGC9434; Monocyte Chemotactic And Act
-
AA Sequence
QPDAINSPVTCCYTLTSKKISMQRLMSYRRVTSSKCPKEAVIFKTIAGKEICAEPKQKWVQDSISHLDKKNQTPKP
-
Predicted Molecular Mass
9.4 kDa
-
Molecular Weight
Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
