Animal-Free IL-4 Protein, Pig (His)

IL-4 protein actively engages in B-cell activation processes and various cell types, acting as a DNA synthesis costimulator. It induces class II MHC molecule expression on resting B-cells and enhances IgE and IgG1 secretion and cell surface expression. Moreover, IL-4 regulates CD23 expression on lymphocytes and monocytes, positively impacting IL31RA expression in macrophages. Additionally, it induces autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4. Animal-Free IL-4 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-4 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free IL-4 Protein, Pig (His) is 109 a.a., with molecular weight of ~13.5 kDa.

IL-4 protein actively participates in several B-cell activation processes and various cell types, serving as a costimulator of DNA synthesis. It induces the expression of class II MHC molecules on resting B-cells, enhances the secretion and cell surface expression of IgE and IgG1, and regulates the expression of the low affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Additionally, IL-4 positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

Pig

E. coli

C-His

Q04745 (H25-C133)

397225  [NCBI]

MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC

Approximately 13.5 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.