Animal-Free RANK L/TNFSF11 Protein, Human (His)

RANK L/TNFSF11 protein is a cytokine that binds to TNFRSF11B/OPG and TNFRSF11A/RANK and serves as a key regulator of osteoclast differentiation and activation. In addition, it is a factor that enhances the ability of dendritic cells to stimulate naive T cell proliferation, indicating its importance in regulating the interaction between T cells and dendritic cells, as well as its potential role in T cell-dependent immune responses. Animal-Free RANK L/TNFSF11 Protein, Human (His) is the recombinant human-derived animal-FreeRANK L/TNFSF11 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free RANK L/TNFSF11 Protein, Human (His) is 175 a.a., with molecular weight of ~20.67 kDa.

RANK L/TNFSF11 protein, a cytokine, binds to TNFRSF11B/OPG and TNFRSF11A/RANK, functioning as a crucial regulator of osteoclast differentiation and activation. Additionally, it serves as a factor that enhances the ability of dendritic cells to stimulate naive T-cell proliferation, suggesting its importance in the regulation of T-cell and dendritic cell interactions, and a potential role in the T-cell-dependent immune response. Moreover, RANK L/TNFSF11 may play a significant role in enhanced bone resorption observed in conditions like humoral hypercalcemia of malignancy. Its induction of osteoclastogenesis involves the activation of multiple signaling pathways in osteoclast precursor cells, with a key mechanism being the induction of long-lasting oscillations in intracellular calcium concentration, leading to the activation of NFATC1. This transcription factor translocates to the nucleus and initiates osteoclast-specific gene transcription, facilitating osteoclast differentiation. During this process, RANK L/TNFSF11, in a TMEM64 and ATP2A2-dependent manner, induces CREB1 activation and mitochondrial ROS generation, crucial for proper osteoclast formation. Existing as a homotrimer, RANK L/TNFSF11 interacts with TNFRSF11B, TNFRSF11A, FBN1, and TNFAIP6, highlighting its versatile interactions in diverse cellular contexts.

Measure by its ability to induce osteoclast differentiation in RAW264.7 cells. The ED₅₀ for this effect is <10 ng/mL.

Human

E. coli

C-His

O14788 (E143-D317)

8600  [NCBI]

MEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Approximately 20.67 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.