ASAM/CLMP Protein, Rat (HEK293, His)

ASAM/CLMP proteins have emerged as potential key players in cell-cell adhesion, implicating their role in maintaining tissue integrity. Indications of involvement in adipocyte differentiation suggest potential effects on adipose tissue development and obesity regulation. ASAM/CLMP Protein, Rat (HEK293, His) is the recombinant rat-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag. The total length of ASAM/CLMP Protein, Rat (HEK293, His) is 232 a.a., with molecular weight of ~28-35 kDa.

ASAM/CLMP Protein emerges as a potential key player in various cellular processes, with indications of involvement in cell-cell adhesion, suggesting its role in the maintenance of tissue integrity. Furthermore, ASAM/CLMP may play a significant role in adipocyte differentiation, hinting at its potential impact on adipose tissue development and, consequently, the regulation of obesity. Additionally, its requirement for normal small intestine development underscores its importance in the intricate processes governing gastrointestinal tissue formation. Exploring the specific mechanisms by which ASAM/CLMP contributes to cell adhesion, adipocyte differentiation, and intestinal development could provide valuable insights into its multifaceted functions and its potential implications in physiological and pathological contexts.

Rat

HEK293

C-6*His

Q8K1G0 (T18-M232)

286939  [NCBI]

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Approximately 28-35 kDa due to the glycosylation

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.