ASAM/CLMP Protein, Human (HEK293, His)
Based on 1 Customer Validation
ASAM/CLMP Protein, Human (HEK293, His), a recombinant human ASAM/CLMP produced in HEK293 cells, has a His tag. ASAM/CLMP belongs to the CTX (cortical thymocyte marker in Xenopus) family, whose members are type I transmembrane proteins within the immunoglobulin superfamily (IgSF). ASAM/CLMP is a component of epithelial tight junctions. ASAM/CLMP has been implicated in adipocyte maturation and development of obesity. Mutations of the CLMP gene cause Congenital Short Bowel Syndrome (CSBS).
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
ASAM/CLMP Protein, Human (HEK293, His), a recombinant human ASAM/CLMP produced in HEK293 cells, has a His tag. ASAM/CLMP belongs to the CTX (cortical thymocyte marker in Xenopus) family, whose members are type I transmembrane proteins within the immunoglobulin superfamily (IgSF). ASAM/CLMP is a component of epithelial tight junctions. ASAM/CLMP has been implicated in adipocyte maturation and development of obesity. Mutations of the CLMP gene cause Congenital Short Bowel Syndrome (CSBS)[1].
Background
The Coxsackie and adenovirus receptor CXADR or CAR, also known as CAR-like membrane protein (CLMP) acts as a highaffinity receptor for the coxsackie B virus and adenovirus (Ad) serotypes 2 and 5 and belongs to the Junction Adhesion Molecule (JAM) family within the immunoglobulin (Ig) superfamily (IgSF) of proteins that localise in tight junctions and along the lateral membrane of epithelial cells[1].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9H6B4 (T19-M233)
-
Molecular Construction
-
N-term
-
ASAM (T19-M233)
Accession # Q9H6B4 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLMP; Adipocyte-Specific Adhesion Molecule; CXADR Like Cell Adhesion Molecule; Adipocyte Adhesion Molecule; ASAM; CXADR-Like Membrane Protein; ACAM; FLJ22415; Coxsackie- And Adenovirus Receptor-Like Membrane Protein; CSBM; CXADR Like Membrane Protein; CSB
-
AA Sequence
THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM
-
Predicted Molecular Mass
25.4 kDa
-
Molecular Weight
Approximately 30-38 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
