ASAM/CLMP Protein, Human (HEK293, His)

ASAM/CLMP Protein, Human (HEK293, His), a recombinant human ASAM/CLMP produced in HEK293 cells, has a His tag. ASAM/CLMP belongs to the CTX (cortical thymocyte marker in Xenopus) family, whose members are type I transmembrane proteins within the immunoglobulin superfamily (IgSF). ASAM/CLMP is a component of epithelial tight junctions. ASAM/CLMP has been implicated in adipocyte maturation and development of obesity. Mutations of the CLMP gene cause Congenital Short Bowel Syndrome (CSBS)^[1] .

The Coxsackie and adenovirus receptor CXADR or CAR, also known as CAR-like membrane protein (CLMP) acts as a highaffinity receptor for the coxsackie B virus and adenovirus (Ad) serotypes 2 and 5 and belongs to the Junction Adhesion Molecule (JAM) family within the immunoglobulin (Ig) superfamily (IgSF) of proteins that localise in tight junctions and along the lateral membrane of epithelial cells^[1].

Human

HEK293

C-6*His

Q9H6B4 (T19-M233)

79827  [NCBI]

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGMHHHHHH

Approximately 35.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Elena Ortiz-Zapater, et al. CAR: A key regulator of adhesion and inflammation. Int J Biochem Cell Biol. 2017 Aug;89:1-5.  [Content Brief]