CD276/B7-H3 Protein, Mouse (HEK293, His)

CD276/B7-H3 Protein, Mouse (HEK293, His) is induced upon T cell activation. B7-H3 selectively increases the production of IFN-γ^[1].

Interaction of B7-H3 and its T cell counter-receptor induces proliferation of both CD4+ and CD8+ T cells and enhances the induction of cytotoxic T cells (CTLs). B7-H3 has the four conserved cysteine residues that thought to be involved in the formation of V- and C-like Ig domains^[1].
Human B7-H3 binds to activated T cells and costimulates their proliferation and, most potently, IFN-γ production. Mouse B7-H3 does not bind significantly to CD4 or CD8 cells from C57BL/6 lymph node cells^[2].

Mouse

HEK293

C-6*His

Q8VE98 (V29-F244)

102657  [NCBI]

VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFHHHHHH

Approximately 38.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. A I Chapoval, et al. B7-H3: a costimulatory molecule for T cell activation and IFN-gamma production. Nat Immunol. 2001 Mar;2(3):269-74.  [Content Brief]

  [2]. Mingyi Sun, et al. Characterization of Mouse and Human B7-H3 Genes1. J Immunol 2002; 168:6294-6297.