CD276/B7-H3 Protein, Mouse (HEK293, His)
Based on 1 publication(s) in Google Scholar
CD276/B7-H3 Protein, Mouse (HEK293, His) is induced upon T cell activation. B7-H3 selectively increases the production of IFN-γ.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CD276/B7-H3 Protein, Mouse (HEK293, His) is induced upon T cell activation. B7-H3 selectively increases the production of IFN-γ[1].
Background
Interaction of B7-H3 and its T cell counter-receptor induces proliferation of both CD4+ and CD8+ T cells and enhances the induction of cytotoxic T cells (CTLs). B7-H3 has the four conserved cysteine residues that thought to be involved in the formation of V- and C-like Ig domains[1].
Human B7-H3 binds to activated T cells and costimulates their proliferation and, most potently, IFN-γ production. Mouse B7-H3 does not bind significantly to CD4 or CD8 cells from C57BL/6 lymph node cells[2].
Verified Bioactivity
Loaded Vobramitamab (HY-P99101) on AHC2 biosensor, can bind CD276/B7-H3 Protein, Mouse (HEK293, His) with an affinity constant of 1.825E-09 M as determined in BLI assay.
MCE Validation Data
-
Bioactivity - BLI
Bioactivity - BLI
-
Bioactivity - SPR
Bioactivity - SPR
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Nat Biotechnol
A logic-gated trispecific engager enhances macrophage killing of cancer cells in solid tumors. [Abstract]2026 Mar 13. PMID: 41826511
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8VE98 (V29-F244)
-
Molecular Construction
-
N-term
-
CD276 (V29-F244)
Accession # Q8VE98 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD276; Costimulatory Molecule; CD276 Molecule; B7 Homolog 3; CD276 Antigen; B7RP-2; B7-H3; 4Ig-B7-H3; B7H3
-
AA Sequence
VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTF
-
Predicted Molecular Mass
24.3 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
