B7-H6 Protein, Human (HEK293, His)

B7-H6 Protein, Human (HEK293, His) suppresses the initiation of the “caspase cascade” and induces anti-apoptosis by STAT3 pathway activation to provoke tumorigenesis^[1][12].

B7 homolog 6 (B7-H6), a novel member of the B7 family, was identified on tumor cell surfaces in 2009^[1]. B7 homolog 6 (B7-H6) has been identified as involved in tumorigenesis. B7-H6 induces cellular cytotoxicity, secretion of TNF-α and IFN-γ and B7-H6-specific BiTE triggers T cells to accelerate tumorigenesis. B7-H6 induces abnormal immunological progression by HER2-scFv mediated ADCC and NKp30 immune escape to promote tumorigenesis. B7-H6 promotes tumorigenesis via apoptosis inhibition, proliferation and immunological progression. B7-H6 may a valuable potential biomarker and therapeutic strategy for diagnostics, prognostics and treatment in cancer^[2].

Immobilized recombinant Human B7 Homolog 6, His (HEK293-expressed) (rHuB7-H6, His) at 2μg/ml (100 μL/ well) can bind NCR3-Fc. The ED50 of recombinant Human B7 Homolog 6, His (HEK293-expressed) (rHuB7-H6, His) is 6.40 ug/mL.

Human

HEK293

C-6*His

Q68D85 (D25-S262)

374383  [NCBI]

DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSHHHHHH

40-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Jing Sun, et al. Clinical significance of novel costimulatory molecule B7-H6 in human breast cancer. Oncol Lett. 2017 Aug;14(2):2405-2409.  [Content Brief]

  [2]. Yuxuan Hu, et al. Immunological role and underlying mechanisms of B7-H6 in tumorigenesis. Clin Chim Acta. 2020 Mar;502:191-198.  [Content Brief]