Cathepsin C/DPPI Protein, Mouse (Inactive, His-Myc)
Based on 1 Customer Validation
The cathepsin C/DPPI protein is a thiol protease that acts as a dipeptidyl peptidase with multiple substrate specificities, excluding proline at the P1 position and arginine at the P2 position. It has both exopeptidase and endopeptidase functions and can activate serine proteases such as elastase, cathepsin G, and granzymes A and B. Cathepsin C/DPPI Protein, Mouse (Inactive, His-Myc) is the recombinant mouse-derived Cathepsin C/DPPI protein, expressed by E. coli , with N-10*His, C-Myc labeled tag. The accession of Cathepsin C/DPPI Protein, Mouse (Inactive, His-Myc) is P97821 (D25-W134).
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The cathepsin C/DPPI protein is a thiol protease that acts as a dipeptidyl peptidase with multiple substrate specificities, excluding proline at the P1 position and arginine at the P2 position. It has both exopeptidase and endopeptidase functions and can activate serine proteases such as elastase, cathepsin G, and granzymes A and B. Cathepsin C/DPPI Protein, Mouse (Inactive, His-Myc) is the recombinant mouse-derived Cathepsin C/DPPI protein, expressed by E. coli , with N-10*His, C-Myc labeled tag. The accession of Cathepsin C/DPPI Protein, Mouse (Inactive, His-Myc) is P97821 (D25-W134).
Background
Cathepsin C/DPPI Protein, functioning as a thiol protease, exhibits dipeptidylpeptidase activity with efficacy against a diverse spectrum of dipeptide substrates comprising polar and hydrophobic amino acids. Notably, the P1 position cannot accommodate proline, and the P2 position cannot accommodate arginine in the substrate. This thiol protease displays versatility as both an exopeptidase and an endopeptidase. Its functional repertoire extends to the activation of serine proteases, including elastase, cathepsin G, and granzymes A and B. The broad substrate specificity and multifunctional roles of Cathepsin C/DPPI highlight its significance in the intricate network of proteolytic processes, implicating its involvement in diverse cellular functions and regulatory pathways.
Verified Bioactivity
No Enzyme activity.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
P97821 (D25-W134)
-
Gene ID13032
-
Molecular Construction
-
N-term
-
10*His
-
CTSC (D25-W134)
Accession # P97821 -
C-term
-
-
Protein Length
Full Length of Ctsc exclusion domain chain
-
Synonyms
CTSC; Dipeptidyl Peptidase I; Prev. PALS; CPPI; Prev. PLS; DPPI; Dipeptidyl Peptidase 1; Dipeptidyl Peptidase 1 Isoform A Preproprotein; Dipeptidyl Transferase; PDON1; Cathepsin J; HMS; DPP1; JPD; Dipeptidyl-Peptidase I; JP; Cathepsin C; DPP-I
-
AA Sequence
DTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKYEVRGHTAISYCHETMTGWVHDVLGRNW
-
Molecular Weight
Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
