Copy Link Print Information

CBR1 Protein, Human (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

CBR1 is an NADPH-dependent reductase with broad substrate specificity and plays a key role in the reduction of various carbonyl compounds, including quinones, prostaglandins, menadione, and xenobiotics. Crucially, CBR1 converts the anthracyclines doxorubicin and daunorubicin into their cardiotoxic forms doxorubicin and daunorubicin. CBR1 Protein, Human (P.pastoris, His) is the recombinant human-derived CBR1 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CBR1 Protein, Human (P.pastoris, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CBR1 is an NADPH-dependent reductase with broad substrate specificity and plays a key role in the reduction of various carbonyl compounds, including quinones, prostaglandins, menadione, and xenobiotics. Crucially, CBR1 converts the anthracyclines doxorubicin and daunorubicin into their cardiotoxic forms doxorubicin and daunorubicin. CBR1 Protein, Human (P.pastoris, His) is the recombinant human-derived CBR1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

CBR1, an NADPH-dependent reductase, exhibits broad substrate specificity and plays a pivotal role in the reduction of diverse carbonyl compounds, encompassing quinones, prostaglandins, menadione, and various xenobiotics. Notably, CBR1 catalyzes the conversion of the antitumor anthracyclines doxorubicin and daunorubicin into their cardiotoxic counterparts, doxorubicinol and daunorubicinol. Moreover, it demonstrates the ability to transform prostaglandin E into prostaglandin F2-alpha, highlighting its versatility in substrate recognition. The enzyme's interaction with glutathione, evidenced by binding to glutathione-conjugated substrates, further elucidates its higher affinity for specific compounds. Additionally, CBR1 participates in glucocorticoid metabolism by facilitating the NADPH-dependent conversion of cortisol/corticosterone to 20beta-dihydrocortisol (20b-DHF) or 20beta-corticosterone (20b-DHB), both of which act as weak agonists for NR3C1 and NR3C2 in adipose tissue.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag N-6*His
  • Accession

    P16152 (S2-W277)

  • Gene ID
    873  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • CBR1 (S2-W277)
      Accession # P16152
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CBR1; Carbonyl Reductase [NADPH] 1; Prev. CBR; Short Chain Dehydrogenase/Reductase Family 21C, Member 1; SDR21C1; 15-Hydroxyprostaglandin Dehydrogenase [NADP(+)]; Short Chain Dehydrogenase/Reductase Family 21C Member 1; Epididymis Secretory Sperm Binding Protein; 20-Beta-Hydroxysteroid Dehydrogenase; 15-Hydroxyprostaglandin Dehydrogenase; NADPH-Dependent Carbonyl Reductase 1; Carbonyl Reductase (NADPH) 1; Alcohol Dehydrogenase [NAD(P)+] CBR1; Carbonyl Reductase (NADPH); Prostaglandin-E(2) 9-Reductase; HCBR1; Prostaglandin 9-Ketoreductase; CRN; Carbonyl Reductase 1; PG-9-KR

  • AA Sequence

    SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

  • Predicted Molecular Mass

    32.2 kDa

  • Molecular Weight

    Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 3% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CBR1 Protein, Human (P.pastoris, His) Product Image
    1/16
  • CBR1 Protein, Human (P.pastoris, His) Product Image