CBR1 Protein, Human (P.pastoris, His)

CBR1 is an NADPH-dependent reductase with broad substrate specificity and plays a key role in the reduction of various carbonyl compounds, including quinones, prostaglandins, menadione, and xenobiotics. Crucially, CBR1 converts the anthracyclines doxorubicin and daunorubicin into their cardiotoxic forms doxorubicin and daunorubicin. CBR1 Protein, Human (P.pastoris, His) is the recombinant human-derived CBR1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of CBR1 Protein, Human (P.pastoris, His) is 276 a.a., with molecular weight of ~33.0 kDa.

CBR1, an NADPH-dependent reductase, exhibits broad substrate specificity and plays a pivotal role in the reduction of diverse carbonyl compounds, encompassing quinones, prostaglandins, menadione, and various xenobiotics. Notably, CBR1 catalyzes the conversion of the antitumor anthracyclines doxorubicin and daunorubicin into their cardiotoxic counterparts, doxorubicinol and daunorubicinol. Moreover, it demonstrates the ability to transform prostaglandin E into prostaglandin F2-alpha, highlighting its versatility in substrate recognition. The enzyme's interaction with glutathione, evidenced by binding to glutathione-conjugated substrates, further elucidates its higher affinity for specific compounds. Additionally, CBR1 participates in glucocorticoid metabolism by facilitating the NADPH-dependent conversion of cortisol/corticosterone to 20beta-dihydrocortisol (20b-DHF) or 20beta-corticosterone (20b-DHB), both of which act as weak agonists for NR3C1 and NR3C2 in adipose tissue.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

P. pastoris

N-6*His

P16152 (S2-W277)

873  [NCBI]

SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Approximately 33.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.2 μm filtered solution in 20 mM Tris-HC1, 0.5 M NaCl, 3% Trehalose, pH 8.0.

<1.0 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.