CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc)

CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc) is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Mouse (HEK293,  Fc) is a recombinant mouse CCL24/Eotaxin-2 (V27-V119) protein expressed by HEK293 with a hFc tag at the N-terminus^[1].

CCL24, also known as eosinophil chemotactic protein 2 (eotaxin-2) and myeloid progenitor inhibitory factor 2 (MPIF-2), is a small cytokine of the CC chemokine family, located on chromosome 7 in the human genome. CCL24 is highly chemotactic for resting T lymphocytes and eosinophils and has low chemotactic activity for neutrophils, but not for monocytes and activated lymphocytes. By binding to its sole receptor CCR3, of which CCR3, is present mainly on eosinophils, but also on basophils, monocytes, Th2 lymphocytes, epithelial cells and airway smooth muscle. CCL24 mainly mediates atopic diseases, parasitic infections and systemic diseases, but also promotes cellular transport and regulates inflammatory and fibrotic activities^[1][2].

CCL24 deficiency leads to reduced dermal thickness and infiltration of immune cells into the bronchoalveolar lavage (BAL) fluid and significantly reduced α-SMA expression in a mouse model of bleomycin (BLM)-induced skin fibrosis^[3].

Measured by its ability to chemoattract BaF3 mouse proB cells transfected with mouse CCR3. The ED₅₀ for this effect is 2.001 ng/mL, corresponding to a specific activity is 4.998×10⁵ U/mg.

• 
  Measured by its ability to chemoattract BaF3 mouse proB cells transfected with mouse CCR3. The ED₅₀ for this effect is 2.001 ng/mL, corresponding to a specific activity is 4.998×10⁵ U/mg.

Mouse

HEK293

N-hFc

Q9JKC0 (V27-V119)

56221  [NCBI]

Full Length of Mature Protein

VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Hui Li, et al. Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy. Int J Clin Exp Pathol. 2013 May 15;6(6):1028-37.  [Content Brief]

  [2]. Michal Segal-Salto, et al. A blocking monoclonal antibody to CCL24 alleviates liver fibrosis and inflammation in experimental models of liver damage. JHEP Rep. 2020 Jan 2;2(1):100064.  [Content Brief]

  [3]. Adi Mor, et al. Blockade of CCL24 with a monoclonal antibody ameliorates experimental dermal and pulmonary fibrosis. Ann Rheum Dis. 2019 Sep;78(9):1260-1268.  [Content Brief]