CCL6 Protein, Rat (His)
Based on 1 Customer Validation
The CCL6 protein is part of the intercrine beta family, a component of chemokines involved in intercellular communication and immune responses. In this family, CCL6 may play an important role in regulating inflammatory processes and cellular interactions. CCL6 Protein, Rat (His) is the recombinant rat-derived CCL6 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CCL6 protein is part of the intercrine beta family, a component of chemokines involved in intercellular communication and immune responses. In this family, CCL6 may play an important role in regulating inflammatory processes and cellular interactions. CCL6 Protein, Rat (His) is the recombinant rat-derived CCL6 protein, expressed by E. coli , with N-6*His labeled tag.
Background
CCL6 protein is a member of the intercrine beta (chemokine CC) family, placing it within a group of chemokines known for their involvement in intercellular communication and immune responses. As part of the intercrine beta family, CCL6 likely plays a significant role in modulating inflammatory processes and cellular interactions. Further exploration is necessary to unveil the specific functions and implications of CCL6 within the broader context of the chemokine CC family, shedding light on its importance in mediating immune responses and contributing to the dynamic network of intercellular signaling.
Verified Bioactivity
Measured in a cell proliferation assay using HUVEC cells.The ED50 for this effect is 15.84 ng/mL, corresponding to a specific activity is 6.313×104 units/mg.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-6*His
-
Accession
Q68FP3 (G22-A115)
-
Molecular Construction
-
N-term
-
6*His
-
CCL6 (G22-A115)
Accession # Q68FP3 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Ccl6; Small-inducible cytokine A6; C-C motif chemokine 6
-
AA Sequence
GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA
-
Predicted Molecular Mass
10.4 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
