1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL6
  6. CCL6 Protein, Rat (N-His)

CCL6 Protein, Rat (N-His)

Cat. No.: HY-P700281
SDS COA Handling Instructions

CCL6 Protein, part of the intercrine beta family, is integral to chemokines involved in intercellular communication and immune responses. Within this family, CCL6 likely plays a significant role in modulating inflammatory processes and cellular interactions. Further exploration is needed to unveil specific functions and implications within the broader chemokine CC family, highlighting its importance in mediating immune responses and contributing to the dynamic network of intercellular signaling. CCL6 Protein, Rat (N-His) is the recombinant rat-derived CCL6 protein, expressed by E. coli, with N-6*His labeled tag. The total length of CCL6 Protein, Rat (N-His) is 94 a.a., with molecular weight of ~12 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $65 In-stock
10 μg $181 In-stock
50 μg $506 In-stock
100 μg $860 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CCL6 Protein, part of the intercrine beta family, is integral to chemokines involved in intercellular communication and immune responses. Within this family, CCL6 likely plays a significant role in modulating inflammatory processes and cellular interactions. Further exploration is needed to unveil specific functions and implications within the broader chemokine CC family, highlighting its importance in mediating immune responses and contributing to the dynamic network of intercellular signaling. CCL6 Protein, Rat (N-His) is the recombinant rat-derived CCL6 protein, expressed by E. coli, with N-6*His labeled tag. The total length of CCL6 Protein, Rat (N-His) is 94 a.a., with molecular weight of ~12 kDa.

Background

CCL6 protein is a member of the intercrine beta (chemokine CC) family, placing it within a group of chemokines known for their involvement in intercellular communication and immune responses. As part of the intercrine beta family, CCL6 likely plays a significant role in modulating inflammatory processes and cellular interactions. Further exploration is necessary to unveil the specific functions and implications of CCL6 within the broader context of the chemokine CC family, shedding light on its importance in mediating immune responses and contributing to the dynamic network of intercellular signaling.

Biological Activity

Measured in a cell proliferation assay using HUVEC cells.The ED50 for this effect is 15.84 ng/mL, corresponding to a specific activity is 6.313×104 units/mg.

  • Measured in a cell proliferation assay using HUVEC cells.The ED50 for this effect is 15.84 ng/mL, corresponding to a specific activity is 6.313×104 units/mg.
Species

Rat

Source

E. coli

Tag

N-6*His

Accession

Q68FP3 (G22-A115)

Gene ID
Molecular Construction
N-term
6*His
CCL6 (G22-A115)
Accession # Q68FP3
C-term
Synonyms
Ccl6C-C motif chemokine 6; Small-inducible cytokine A6
AA Sequence

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Molecular Weight

Approximately 12 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CCL6 Protein, Rat (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCL6 Protein, Rat (N-His)
Cat. No.:
HY-P700281
Quantity:
MCE Japan Authorized Agent: