CCL6 Protein, Rat (N-His)

CCL6 Protein, part of the intercrine beta family, is integral to chemokines involved in intercellular communication and immune responses. Within this family, CCL6 likely plays a significant role in modulating inflammatory processes and cellular interactions. Further exploration is needed to unveil specific functions and implications within the broader chemokine CC family, highlighting its importance in mediating immune responses and contributing to the dynamic network of intercellular signaling. CCL6 Protein, Rat (N-His) is the recombinant rat-derived CCL6 protein, expressed by E. coli, with N-6*His labeled tag. The total length of CCL6 Protein, Rat (N-His) is 94 a.a., with molecular weight of ~12 kDa.

CCL6 protein is a member of the intercrine beta (chemokine CC) family, placing it within a group of chemokines known for their involvement in intercellular communication and immune responses. As part of the intercrine beta family, CCL6 likely plays a significant role in modulating inflammatory processes and cellular interactions. Further exploration is necessary to unveil the specific functions and implications of CCL6 within the broader context of the chemokine CC family, shedding light on its importance in mediating immune responses and contributing to the dynamic network of intercellular signaling.

Measured in a cell proliferation assay using HUVEC cells.The ED₅₀ for this effect is 15.84 ng/mL, corresponding to a specific activity is 6.313×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using HUVEC cells.The ED₅₀ for this effect is 15.84 ng/mL, corresponding to a specific activity is 6.313×10⁴ units/mg.

Rat

E. coli

N-6*His

Q68FP3 (G22-A115)

287910  [NCBI]

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Approximately 12 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.