CCR8 Protein, Human (Cell-Free, His)

CCR8 Protein-VLP, a receptor for CCL1/SCYA1/I-309, may regulate monocyte chemotaxis and thymic cell line apoptosis. It also acts as an alternative coreceptor with CD4 for HIV-1 infection, facilitating viral entry. The interaction with CCL1 highlights its role in mediating cellular responses to this chemokine, implying a regulatory function in immune and inflammatory processes. CCR8 Protein, Human (Cell-Free, His) is the recombinant human-derived CCR8 protein, expressed by E. coli Cell-free, with N-10*His labeled tag. The total length of CCR8 Protein, Human (Cell-Free, His) is 56 a.a., with molecular weight of 9.4 kDa.

The CCR8 Protein-VLP acts as a receptor for the chemokine CCL1/SCYA1/I-309, potentially regulating monocyte chemotaxis and thymic cell line apoptosis. It also serves as an alternative coreceptor with CD4 for HIV-1 infection, implicating its involvement in facilitating viral entry and infection. The interaction between CCR8 and CCL1 underscores its role in mediating cellular responses to this chemokine, suggesting a regulatory function in immune and inflammatory processes.

Human

E. coli Cell-free

N-10*His

P51685 (L74-V129)

1237  [NCBI]

LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV

9.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.