CCR9 Protein, Human (GST)

CCR9 Protein, a receptor for SCYA25/TECK, activates signaling, elevating intracellular calcium ions. In microbial infection, it acts as an alternative HIV-1 coreceptor with CD4, influencing the infection process. CCR9 Protein, Human (GST) is the recombinant human-derived CCR9 protein, expressed by E. coli , with N-GST labeled tag. The total length of CCR9 Protein, Human (GST) is 48 a.a., with molecular weight of 33 kDa.

The CCR9 Protein functions as a receptor for the chemokine SCYA25/TECK, leading to the transduction of a signal that increases intracellular calcium ion levels. In the context of microbial infection, it acts as an alternative coreceptor with CD4 for HIV-1, contributing to the infection process.

Human

E. coli

N-GST

P51686 (M1-S48)

10803  [NCBI]

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFAS

33 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.