CCR9 Protein, Human (GST)
Based on 1 Customer Validation
CCR9 Protein, a receptor for SCYA25/TECK, activates signaling, elevating intracellular calcium ions. In microbial infection, it acts as an alternative HIV-1 coreceptor with CD4, influencing the infection process. CCR9 Protein, Human (GST) is the recombinant human-derived CCR9 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CCR9 Protein, a receptor for SCYA25/TECK, activates signaling, elevating intracellular calcium ions. In microbial infection, it acts as an alternative HIV-1 coreceptor with CD4, influencing the infection process. CCR9 Protein, Human (GST) is the recombinant human-derived CCR9 protein, expressed by E. coli , with N-GST labeled tag.
The CCR9 Protein functions as a receptor for the chemokine SCYA25/TECK, leading to the transduction of a signal that increases intracellular calcium ion levels. In the context of microbial infection, it acts as an alternative coreceptor with CD4 for HIV-1, contributing to the infection process.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P51686-1 (M1-S48)
-
Molecular Construction
-
N-term
-
GST
-
CCR9 (M1-S48)
Accession # P51686-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CCR9; CC-CKR-9; Prev. GPR28; G-Protein Coupled Receptor 28; GPR-9-6; CCR9 Chemokine Receptor; CDw199; CDw199 Antigen; Chemokine (C-C Motif) Receptor 9; C-C CKR-9; C-C Chemokine Receptor Type 9; CCR-9; C-C Motif Chemokine Receptor 9; G Protein-Coupled Rece
-
AA Sequence
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFAS
-
Predicted Molecular Mass
31.9 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (232 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
