CD20 Protein, Human (Trx)

CD20/MS4A1 Protein, a B-lymphocyte membrane protein, crucially regulates cellular calcium influx, essential for B-lymphocyte development, differentiation, and activation. As part of the store-operated calcium (SOC) channel, it promotes calcium influx upon B-cell receptor/BCR activation. CD20/MS4A1 forms homotetramers, contributing to its structural organization in calcium signaling. Interacting with both heavy and light chains of cell surface IgM, the antigen-binding components of the BCR, emphasizes its involvement in the B-cell receptor complex, underscoring significance in B-cell activation and immune responses. CD20 Protein, Human (Trx) is the recombinant human-derived CD20 protein, expressed by E. coli, with N-Trx labeled tag. The total length of CD20 Protein, Human (Trx) is 48 a.a., with molecular weight of 28.2 kDa.

The CD20/MS4A1 protein, a B-lymphocyte-specific membrane protein, plays a crucial role in regulating cellular calcium influx essential for the development, differentiation, and activation of B-lymphocytes. It functions as a component of the store-operated calcium (SOC) channel, promoting calcium influx upon activation by the B-cell receptor/BCR. CD20/MS4A1 forms homotetramers, contributing to its structural organization and functional role in calcium signaling. Notably, it interacts with both the heavy and light chains of cell surface IgM, the antigen-binding components of the BCR, highlighting its involvement in the B-cell receptor complex and underscoring its significance in B-cell activation and immune responses.

Human

E. coli

N-Trx

P11836/NP_068769.2 (I141-S188)

931  [NCBI]

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

28.2 kDa

Greater than 80% as determined by reducing SDS-PAGE.