CD20/MS4A1 Protein, Mouse (P.pastoris, His)

CD20/MS4A1 protein regulates cellular calcium influx, essential for B-lymphocyte development, differentiation, and activation. It activates store-operated calcium channels, allowing calcium influx through B-cell receptor/BCR activation. CD20/MS4A1 protein forms homotetramers and interacts with cell surface IgM chains, the antigen-binding parts of the BCR. CD20/MS4A1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived CD20/MS4A1 protein, expressed by P. pastoris , with N-6*His labeled tag.

CD20/MS4A1 protein is a B-lymphocyte-specific membrane protein that plays a crucial role in regulating cellular calcium influx, which is necessary for the development, differentiation, and activation of B-lymphocytes. It functions as a component of store-operated calcium (SOC) channels, promoting calcium influx upon activation by the B-cell receptor/BCR. CD20/MS4A1 protein forms homotetramers and interacts with the heavy and light chains of cell surface IgM, which are the antigen-binding components of the BCR.

Measured by its binding ability in a functional ELISA. Immobilized Mouse CD20, at 2 μg/mL (100 μL/well) can bind Anti-CD20 antibody. The ED₅₀ for this effect is 1.066 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Mouse CD20, at 2 μg/mL (100 μL/well) can bind Anti-CD20 antibody. The ED₅₀ for this effect is 1.066 μg/mL.

Mouse

P. pastoris

N-6*His

P19437 (V111-P291)

12482  [NCBI]

Partial

VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Approximately 33 kDa.The reducing (R) protein migrat es as 33 kDa in SDS-PAGE may be due to glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.