CD20/MS4A1 Protein, Cynomolgus (85a.a, HEK293, His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Cynomolgus (85a.a, HEK293, His) is the recombinant cynomolgus-derived CD20/MS4A1 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD20/MS4A1 Protein, Cynomolgus (85a.a, HEK293, His) is 85 a.a., with molecular weight of 22.66 & 24.28 kDa, respectively.

The CD20/MS4A1 protein, a B-lymphocyte-specific membrane protein, plays a crucial role in regulating cellular calcium influx essential for the development, differentiation, and activation of B-lymphocytes. It functions as a component of the store-operated calcium (SOC) channel, promoting calcium influx upon activation by the B-cell receptor/BCR. CD20/MS4A1 forms homotetramers, contributing to its structural organization and functional role in calcium signaling. Notably, it interacts with both the heavy and light chains of cell surface IgM, the antigen-binding components of the BCR, highlighting its involvement in the B-cell receptor complex and underscoring its significance in B-cell activation and immune responses.

Measured in a cytotoxicity assay using Ramos cells. The ED₅₀ this effect is 23.57 ng/mL, corresponding to a specific activity is 4.243×10⁴ units/mg.

• 
  Measured in a cytotoxicity assay using Ramos cells. The ED₅₀ for this effect is 23.57 ng/mL, corresponding to a specific activity is 4.243×10⁴ units/mg.

Cynomolgus

HEK293

C-His

NP_001274241 (E213-P297)

102118491  [NCBI]

ENEWRRTCSRPKSSVVLLSAEEKKEQVIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP

22.66 & 24.28 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.