CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (217a.a, HEK293, Myc-hFc)
CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (217a.a, HEK293, Myc-hFc) is the recombinant human-derived CD276/B7-H3 protein, expressed by HEK293 , with C-Myc, C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (217a.a, HEK293, Myc-hFc) is the recombinant human-derived CD276/B7-H3 protein, expressed by HEK293 , with C-Myc, C-hFc labeled tag.
Background
The CD276/B7-H3 protein is suggested to play a multifaceted role in the regulation of T-cell-mediated immune responses, potentially acting as a protective factor in tumor cells by inhibiting natural-killer-mediated cell lysis and serving as a marker for the detection of neuroblastoma cells. Additionally, CD276/B7-H3 may be involved in the development of acute and chronic transplant rejection, contributing to the regulation of lymphocytic activity at mucosal surfaces. Notably, it could play a crucial role in providing the placenta and fetus with an immunologically suitable environment throughout pregnancy. Both isoform 1 and isoform 2 of CD276/B7-H3 appear redundant in their ability to modulate CD4 T-cell responses, with isoform 2 demonstrated to enhance the induction of cytotoxic T-cells and selectively stimulate interferon-gamma production in the presence of T-cell receptor signaling. The interaction with TREML2 is identified as enhancing T-cell activation, highlighting the diverse roles CD276/B7-H3 may play in immune regulation and cellular responses.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Myc;C-hFc
-
Accession
Q5ZPR3-1 (L29-G245)
-
Molecular Construction
-
N-term
-
CD276 (L29-G245)
Accession # Q5ZPR3-1 -
hFc-Myc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CD276; Costimulatory Molecule; CD276 Molecule; B7 Homolog 3; CD276 Antigen; B7RP-2; B7-H3; 4Ig-B7-H3; B7H3
-
AA Sequence
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG
-
Predicted Molecular Mass
53.4 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
