CD276/B7-H3 Protein, Human (HEK293, Myc-hFc)

CD276/B7-H3 Protein may regulate T-cell-mediated immune responses, acting as a protective factor in tumor cells by inhibiting natural-killer-mediated cell lysis. It also serves as a neuroblastoma cell marker and plays a role in acute and chronic transplant rejection, regulating lymphocytic activity at mucosal surfaces. Crucially, CD276/B7-H3 may provide an immunologically suitable environment for the placenta and fetus during pregnancy. Both isoforms modulate CD4 T-cell responses, with isoform 2 enhancing cytotoxic T-cells and selectively stimulating interferon-gamma production. Interaction with TREML2 enhances T-cell activation, highlighting CD276/B7-H3's diverse roles in immune regulation and cellular responses. CD276/B7-H3 Protein, Human (HEK293, Myc-hFc) is the recombinant human-derived CD276/B7-H3 protein, expressed by HEK293, with C-Myc, C-hFc labeled tag. The total length of CD276/B7-H3 Protein, Human (HEK293, Myc-hFc) is 217 a.a., with molecular weight of 53.4 kDa.

The CD276/B7-H3 protein is suggested to play a multifaceted role in the regulation of T-cell-mediated immune responses, potentially acting as a protective factor in tumor cells by inhibiting natural-killer-mediated cell lysis and serving as a marker for the detection of neuroblastoma cells. Additionally, CD276/B7-H3 may be involved in the development of acute and chronic transplant rejection, contributing to the regulation of lymphocytic activity at mucosal surfaces. Notably, it could play a crucial role in providing the placenta and fetus with an immunologically suitable environment throughout pregnancy. Both isoform 1 and isoform 2 of CD276/B7-H3 appear redundant in their ability to modulate CD4 T-cell responses, with isoform 2 demonstrated to enhance the induction of cytotoxic T-cells and selectively stimulate interferon-gamma production in the presence of T-cell receptor signaling. The interaction with TREML2 is identified as enhancing T-cell activation, highlighting the diverse roles CD276/B7-H3 may play in immune regulation and cellular responses.

Human

HEK293

C-Myc;C-hFc

Q5ZPR3 (L29-G245)

80381  [NCBI]

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG

53.4 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.