1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD3e
  5. CD3 epsilon Protein, Human (HEK293, His)

CD3 epsilon Protein, Human (HEK293, His)

Cat. No.: HY-P70506
COA Handling Instructions

CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived CD3 epsilon protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD3 epsilon Protein, Human (HEK293, His) is 104 a.a., with molecular weight of ~18.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $100 In-stock
50 μg $280 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived CD3 epsilon protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD3 epsilon Protein, Human (HEK293, His) is 104 a.a., with molecular weight of ~18.0 kDa.

Background

CD3 epsilon, an integral component of the TCR-CD3 complex on the surface of T-lymphocytes, plays a crucial role in the adaptive immune response. As antigen-presenting cells (APCs) activate the T-cell receptor (TCR), CD3 epsilon, along with other CD3 chains (CD3D, CD3G, and CD3Z), facilitates the transmission of TCR-mediated signals across the cell membrane. Containing immunoreceptor tyrosine-based activation motifs (ITAMs) in its cytoplasmic domain, CD3 epsilon undergoes phosphorylation by Src family protein tyrosine kinases LCK and FYN upon TCR engagement, leading to the activation of downstream signaling pathways. Beyond its role in signal transduction, CD3 epsilon is essential for proper T-cell development, initiating the assembly of the TCR-CD3 complex by forming the heterodimers CD3D/CD3E and CD3G/CD3E. Additionally, CD3 epsilon is involved in the internalization and cell surface down-regulation of TCR-CD3 complexes through endocytosis sequences present in its cytosolic region. The TCR-CD3 complex comprises CD3D/CD3E and CD3G/CD3E heterodimers, which preferentially associate with TCRalpha and TCRbeta, forming trimers that interact with CD3Z homodimers to complete the hexameric TCR-CD3 complex. Alternatively, TCRgamma and TCRdelta can replace TCRalpha and TCRbeta. CD3 epsilon's interactions with CD6, NCK1, and NUMB further highlight its pivotal role in orchestrating T-cell activation, development, and internalization processes.

Biological Activity

10 μg/mL (100 μL/well) of immobilized Human CD3E-His can bind Human Anti-CD3 with an ED50 value of 3-15 ng/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P07766 (D23-D126)

Gene ID

916  [NCBI]

Molecular Construction
N-term
CD3 epsilon (D23-D126)
Accession # P07766
6*His
C-term
Synonyms
T-Cell Surface Glycoprotein CD3 Epsilon Chain; T-Cell Surface Antigen T3/Leu-4 Epsilon Chain; CD3e; CD3E; T3E
AA Sequence

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD3 epsilon Protein, Human (HEK293, His)
Cat. No.:
HY-P70506
Quantity:
MCE Japan Authorized Agent: