1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD3e
  5. CD3 epsilon Protein, Mouse (P.pastoris, His)

CD3 epsilon Protein, Mouse (P.pastoris, His)

Cat. No.: HY-P71723
COA Handling Instructions

The CD3 epsilon protein is an important component of the TCR-CD3 complex on T lymphocytes and is critical for adaptive immune responses. After APC activates TCR, CD3E, together with CD3D, CD3G and CD3Z, transmits signals through ITAM and activates downstream pathways. CD3 epsilon Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived CD3 epsilon protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of CD3 epsilon Protein, Mouse (P.pastoris, His) is 86 a.a., with molecular weight of ~11.9 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $94 In-stock
10 μg $160 In-stock
50 μg $450 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD3 epsilon protein is an important component of the TCR-CD3 complex on T lymphocytes and is critical for adaptive immune responses. After APC activates TCR, CD3E, together with CD3D, CD3G and CD3Z, transmits signals through ITAM and activates downstream pathways. CD3 epsilon Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived CD3 epsilon protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of CD3 epsilon Protein, Mouse (P.pastoris, His) is 86 a.a., with molecular weight of ~11.9 kDa.

Background

The CD3 epsilon protein is an integral part of the TCR-CD3 complex located on the surface of T-lymphocytes, playing a crucial role in adaptive immune responses. Upon activation of the T-cell receptor (TCR) by antigen-presenting cells (APCs), CD3E, alongside CD3D, CD3G, and CD3Z, facilitates the transmission of TCR-mediated signals across the cell membrane. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain, which, upon phosphorylation by LCK and FYN kinases, triggers downstream signaling pathways. Beyond its role in signal transduction for T-cell activation, CD3E is indispensable for proper T-cell development. Additionally, it participates in the internalization and cell surface down-regulation of TCR-CD3 complexes through endocytosis sequences present in its cytosolic region. The TCR-CD3 complex comprises CD3D/CD3E and CD3G/CD3E heterodimers that preferentially associate with TCRalpha and TCRbeta, forming trimers. The hexamer interacts with CD3Z homodimer, completing the TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be replaced by TCRgamma and TCRdelta. CD3E also interacts with CD6 and NCK1. This comprehensive network underscores the multifaceted role of CD3E in orchestrating T-cell responses.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

P22646 (D23-D108)

Gene ID

12501  [NCBI]

Molecular Construction
N-term
6*His
CD3 epsilon (D23-D108)
Accession # P22646
C-term
Synonyms
Cd3eT-cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; CD antigen CD3e
AA Sequence

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD

Molecular Weight

Approximately 11.9 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD3 epsilon Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71723
Quantity:
MCE Japan Authorized Agent: