CD300LB Protein, Human (HEK293, hFc)
CD300LB Protein, an activating immune receptor, engages in immune modulation by interacting with the ITAM-bearing adapter TYROBP and recruiting GRB2 independently. The interaction with TYROBP enhances cell surface expression and activation properties. In the presence of FYN, CD300LB also interacts with GRB2, showcasing its multifaceted contribution to immune signaling pathways. CD300LB Protein, Human (HEK293, hFc) is the recombinant human-derived CD300LB protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD300LB Protein, an activating immune receptor, engages in immune modulation by interacting with the ITAM-bearing adapter TYROBP and recruiting GRB2 independently. The interaction with TYROBP enhances cell surface expression and activation properties. In the presence of FYN, CD300LB also interacts with GRB2, showcasing its multifaceted contribution to immune signaling pathways. CD300LB Protein, Human (HEK293, hFc) is the recombinant human-derived CD300LB protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD300LB protein functions as an activating immune receptor, engaging in its immune-modulatory role through interaction with the ITAM-bearing adapter TYROBP and independently by recruiting GRB2. Its interaction with TYROBP not only enhances cell surface expression but also boosts activation properties. In the presence of FYN, CD300LB further interacts with GRB2, revealing a multifaceted mechanism through which this protein contributes to immune signaling pathways.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
AAH28091.1 (I55-H187)
-
Molecular Construction
-
N-term
-
CD300LB (I55-H187)
Accession # AAH28091.1 -
hFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CD300LB; TREM-5; CD300 Molecule Like Family Member B; CLM-7; TREM5; IREM3; CLM7; CD300 Molecule-Like Family Member B; Triggering Receptor Expressed On Myeloid Cells 5; CD300 Antigen-Like Family Member B; Immune Receptor Expressed On Myeloid Cells 3; CD300
-
AA Sequence
IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNH
-
Predicted Molecular Mass
42.2 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
