1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. CLM-7/CD300b
  5. CD300LB Protein, Human (133a.a, HEK293, Fc)

CD300LB Protein, Human (133a.a, HEK293, Fc)

Cat. No.: HY-P72774
Handling Instructions

CD300LB Protein, an activating immune receptor, engages in immune modulation by interacting with the ITAM-bearing adapter TYROBP and recruiting GRB2 independently. The interaction with TYROBP enhances cell surface expression and activation properties. In the presence of FYN, CD300LB also interacts with GRB2, showcasing its multifaceted contribution to immune signaling pathways. CD300LB Protein, Human (133a.a, HEK293, Fc) is the recombinant human-derived CD300LB protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD300LB Protein, Human (133a.a, HEK293, Fc) is 133 a.a., with molecular weight of 50-60 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD300LB Protein, an activating immune receptor, engages in immune modulation by interacting with the ITAM-bearing adapter TYROBP and recruiting GRB2 independently. The interaction with TYROBP enhances cell surface expression and activation properties. In the presence of FYN, CD300LB also interacts with GRB2, showcasing its multifaceted contribution to immune signaling pathways. CD300LB Protein, Human (133a.a, HEK293, Fc) is the recombinant human-derived CD300LB protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD300LB Protein, Human (133a.a, HEK293, Fc) is 133 a.a., with molecular weight of 50-60 kDa.

Background

CD300LB protein functions as an activating immune receptor, engaging in its immune-modulatory role through interaction with the ITAM-bearing adapter TYROBP and independently by recruiting GRB2. Its interaction with TYROBP not only enhances cell surface expression but also boosts activation properties. In the presence of FYN, CD300LB further interacts with GRB2, revealing a multifaceted mechanism through which this protein contributes to immune signaling pathways.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

AAH28091.1 (I55-H187)

Gene ID
Molecular Construction
N-term
CD300LB (I55-H187)
Accession # AAH28091.1
hFc
C-term
Synonyms
CD300b; CLM-7; CLM-7; CMRF35-A2; IREM-3; IREM3; TREM-5; TREM5; CD300LB
AA Sequence

IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNH

Molecular Weight

50-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD300LB Protein, Human (133a.a, HEK293, Fc)
Cat. No.:
HY-P72774
Quantity:
MCE Japan Authorized Agent: