CDK4 Protein, Human (Baculovirus, His)

CDK4 protein, acting as a Ser/Thr kinase in the cyclin D-CDK4 complex, critically regulates the G(1)/S transition by phosphorylating and inhibiting RB family members. This activity, specifically hypophosphorylation of RB1 during early G(1) phase, releases E2F and promotes transcription of genes that drive G(1) progression. CDK4 Protein, Human (Baculovirus, His) is the recombinant human-derived CDK4 protein, expressed by Sf9 insect cells , with N-6*His labeled tag. The total length of CDK4 Protein, Human (Baculovirus, His) is 302 a.a., with molecular weight of 35.6 kDa.

CDK4 protein serves as the Ser/Thr-kinase component within cyclin D-CDK4 (DC) complexes, orchestrating the phosphorylation and inhibition of members belonging to the retinoblastoma (RB) protein family, including RB1. This regulatory activity is pivotal in controlling the cell cycle during the G(1)/S transition. The phosphorylation of RB1 instigates the dissociation of the transcription factor E2F from the RB/E2F complexes, facilitating the subsequent transcription of E2F target genes that drive progression through the G(1) phase. Particularly notable is the hypophosphorylation of RB1 occurring in early G(1) phase. As essential integrators of diverse mitogenic and antimitogenic signals, cyclin D-CDK4 complexes play a central role in cell cycle regulation. Additionally, CDK4 protein exhibits the capability to phosphorylate SMAD3 in a cell-cycle-dependent manner, thereby repressing its transcriptional activity. CDK4 is a crucial component of the ternary complex, cyclin D/CDK4/CDKN1B, which is indispensable for the nuclear translocation and activity of the cyclin D-CDK4 complex.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

Sf9 insect cells

N-6*His

P11802-1 (A2-E303)

1019  [NCBI]

ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

35.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.