1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Stem Cell CD Proteins Epithelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. CD66c/CEACAM6 Immunoglobulin-like Cell Adhesion Molecules
  5. CEA Cell Adhesion Molecule 6 (CEACAM6)
  6. CEACAM6 Protein, Human (286a.a, HEK293, His)

CEACAM6 Protein, Human (286a.a, HEK293, His)

Cat. No.: HY-P700471
Handling Instructions

The CEACAM6 protein is a cell surface glycoprotein that promotes calcium- and fibronectin-independent cell-cell adhesion and mediates homo- and heterosexual interactions with other carcinoembryonic antigen-related cell adhesion molecules. CEACAM6 Protein, Human (286a.a, HEK293, His) is the recombinant human-derived CEACAM6 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of CEACAM6 Protein, Human (286a.a, HEK293, His) is 286 a.a., with molecular weight of 32.6 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CEACAM6 protein is a cell surface glycoprotein that promotes calcium- and fibronectin-independent cell-cell adhesion and mediates homo- and heterosexual interactions with other carcinoembryonic antigen-related cell adhesion molecules. CEACAM6 Protein, Human (286a.a, HEK293, His) is the recombinant human-derived CEACAM6 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of CEACAM6 Protein, Human (286a.a, HEK293, His) is 286 a.a., with molecular weight of 32.6 kDa.

Background

CEACAM6 protein, a cell surface glycoprotein, assumes a pivotal role in cell adhesion and tumor progression. Interactions occur in a calcium- and fibronectin-independent manner, mediating both homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules like CEACAM5 and CEACAM8. Particularly, heterophilic interaction with CEACAM8 takes place in activated neutrophils, influencing neutrophil adhesion to cytokine-activated endothelial cells. In the context of tumor progression, CEACAM6 operates as an oncogene by positively regulating cell migration, adhesion to endothelial cells, and invasion. Additionally, it contributes to the metastatic cascade by inducing resistance to anoikis in pancreatic adenocarcinoma and colorectal carcinoma cells. CEACAM6 forms homodimers, engaging in homodimerization via its Ig-like V-type domain, and also forms heterodimers with CEACAM8 through their respective Ig-like V-type domains, highlighting its multifaceted role in cell adhesion and cancer-related processes.

Species

Human

Source

HEK293

Tag

C-10*His

Accession

P40199 (K35-G320)

Gene ID
Molecular Construction
N-term
CEACAM6 (K35-G320)
Accession # P40199
10*His
C-term
Synonyms
carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen); NCA; carcinoembryonic antigen-related cell adhesion molecule 6; CD66c; normal cross-reacting antigen; non-specific crossreacting antigen; CEAL;
AA Sequence

KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG

Molecular Weight

32.6 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEACAM6 Protein, Human (286a.a, HEK293, His)
Cat. No.:
HY-P700471
Quantity:
MCE Japan Authorized Agent: