Copy Link Print Information

Coagulation factor XIII B/F13B Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Coagulation factor XIII B/F13B Proteinas, the B chain of factor XIII, lacks catalytic activity but stabilizes A subunits and regulates thrombin-initiated transglutaminase formation. Functioning as a tetramer with two A chains (F13A1) and two B chains (F13B), it structurally supports the factor XIII complex, emphasizing its regulatory role in blood coagulation, particularly in transglutaminase activation by thrombin. Coagulation factor XIII B/F13B Protein, Human (HEK293, His) is the recombinant human-derived Coagulation factor XIII B/F13B protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Coagulation factor XIII B/F13B Protein, Human (HEK293, His)
  • Coagulation factor XIII B/F13B Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Coagulation factor XIII B/F13B Proteinas, the B chain of factor XIII, lacks catalytic activity but stabilizes A subunits and regulates thrombin-initiated transglutaminase formation. Functioning as a tetramer with two A chains (F13A1) and two B chains (F13B), it structurally supports the factor XIII complex, emphasizing its regulatory role in blood coagulation, particularly in transglutaminase activation by thrombin. Coagulation factor XIII B/F13B Protein, Human (HEK293, His) is the recombinant human-derived Coagulation factor XIII B/F13B protein, expressed by HEK293 , with C-His labeled tag.

Background

The Coagulation factor XIII B/F13B protein, as the B chain of factor XIII, lacks catalytic activity but is believed to play a crucial role in stabilizing the A subunits and regulating the rate of transglutaminase formation initiated by thrombin. The protein functions as a tetramer composed of two A chains (F13A1) and two B chains (F13B), highlighting its structural significance in the formation and stability of the factor XIII complex. This intricate arrangement underscores the regulatory role of Coagulation factor XIII B/F13B in the enzymatic processes involved in blood coagulation, particularly in the context of transglutaminase activation by thrombin.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession

    P05160 (E21-T661)

  • Gene ID
    2165  [NCBI]
  • Molecular Construction
    • N-term
    • F13B (E21-T661)
      Accession # P05160
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    F13B; Fibrin-Stabilizing Factor B Subunit; Coagulation Factor XIII B Chain; Transglutaminase B Chain; FXIIIB; Alternative Protein F13B; Protein-Glutamine Gamma-Glutamyltransferase B Chain; TGase; Coagulation Factor XIII, B Polypeptide

  • AA Sequence

    EEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMRYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHIECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKVTYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVMNGAVADGILASYATGSSVEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGDLIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSTVDTYENGSSVEYRCFDHHFLEGSREAYCLDGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDFDNRPHILHGEYIEFICRGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQSTLSYQEPLRT

  • Molecular Weight

    Approximately 65 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Coagulation factor XIII B/F13B Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Coagulation factor XIII B/F13B Protein, Human (HEK293, His)
  • Coagulation factor XIII B/F13B Protein, Human (HEK293, His) Product Image