Coagulation factor XIII B/F13B Protein, Human (HEK293, His)

Coagulation factor XIII B/F13B Proteinas, the B chain of factor XIII, lacks catalytic activity but stabilizes A subunits and regulates thrombin-initiated transglutaminase formation. Functioning as a tetramer with two A chains (F13A1) and two B chains (F13B), it structurally supports the factor XIII complex, emphasizing its regulatory role in blood coagulation, particularly in transglutaminase activation by thrombin. Coagulation factor XIII B/F13B Protein, Human (HEK293, His) is the recombinant human-derived Coagulation factor XIII B/F13B protein, expressed by HEK293 , with C-His labeled tag. The total length of Coagulation factor XIII B/F13B Protein, Human (HEK293, His) is 641 a.a., with molecular weight of 80-90 kDa.

The Coagulation factor XIII B/F13B protein, as the B chain of factor XIII, lacks catalytic activity but is believed to play a crucial role in stabilizing the A subunits and regulating the rate of transglutaminase formation initiated by thrombin. The protein functions as a tetramer composed of two A chains (F13A1) and two B chains (F13B), highlighting its structural significance in the formation and stability of the factor XIII complex. This intricate arrangement underscores the regulatory role of Coagulation factor XIII B/F13B in the enzymatic processes involved in blood coagulation, particularly in the context of transglutaminase activation by thrombin.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-10*His

P05160 (E21-T661)

2165  [NCBI]

EEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMRYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHIECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKVTYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVMNGAVADGILASYATGSSVEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGDLIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSTVDTYENGSSVEYRCFDHHFLEGSREAYCLDGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDFDNRPHILHGEYIEFICRGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQSTLSYQEPLRT

Approximately 80-90 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.