1. Recombinant Proteins
  2. CTLA-4 Protein, Mouse (HEK 293, His)

CTLA-4 Protein, Mouse (HEK 293, His)

Cat. No.: HY-P71991
Handling Instructions

CTLA-4 Protein, Mouse (HEK 293, His) is a recombinant CTLA-4 protein with a His-flag. CTLA-4 Protein is a single-pass type I membrane protein and belongs to the CD28 receptor family. CTLA-4 is a negative immune regulator constitutively expressed on Treg cells[1][2].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
2 μg $53 In-stock
Estimated Time of Arrival: December 31
10 μg $135 In-stock
Estimated Time of Arrival: December 31
50 μg $368 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
Ctla4; Cd152; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152
Species

Mouse

Source

HEK 293

Accession

P09793 (A37-D161)

Gene ID

12477

Molecular Weight

Approximately 14.6 kDa

AA Sequence

AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Purity

Greater than 95% as determined by SDS-PAGE.

Biological Activity
The ED50 as determined by its ability to bind Mouse B7-1 in functional ELISA is less than 20 ng/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 1xPBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Background

CTLA-4 and CD28 both belongs to a family of immunoglobulin-related receptors that are responsible for various aspects of T-cell immune regulation. CTLA-4 and CD28 are homologous receptors expressed by both CD4+ and CD8+ T cells, which mediate opposing functions in T cell activation[1].
CTLA-4 interacts with both ligands (CD80 and CD86) with high affinity[1].
CTLA-4 is a negative immune regulator constitutively expressed on Treg cells and upregulated on activated T cells. CTLA-4 inhibits T cell activation by various suppressive functions including competition with CD28, regulation of the inhibitory function of Treg cells, such as transendocytosis, and the control of adhesion and motility[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTLA-4 Protein, Mouse (HEK 293, His)
Cat. No.:
HY-P71991
Quantity:
MCE Japan Authorized Agent: