Copy Link Print Information

CTLA-4 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

CTLA-4 Protein, Mouse (HEK293, His) is a recombinant CTLA-4 protein with a His-flag. CTLA-4 Protein is a single-pass type I membrane protein and belongs to the CD28 receptor family. CTLA-4 is a negative immune regulator constitutively expressed on Treg cells.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CTLA-4 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CTLA-4 Protein, Mouse (HEK293, His) is a recombinant CTLA-4 protein with a His-flag. CTLA-4 Protein is a single-pass type I membrane protein and belongs to the CD28 receptor family. CTLA-4 is a negative immune regulator constitutively expressed on Treg cells[1][2].

Background

CTLA-4 and CD28 both belongs to a family of immunoglobulin-related receptors that are responsible for various aspects of T-cell immune regulation. CTLA-4 and CD28 are homologous receptors expressed by both CD4+ and CD8+ T cells, which mediate opposing functions in T cell activation[1].
CTLA-4 interacts with both ligands (CD80 and CD86) with high affinity[1].
CTLA-4 is a negative immune regulator constitutively expressed on Treg cells and upregulated on activated T cells. CTLA-4 inhibits T cell activation by various suppressive functions including competition with CD28, regulation of the inhibitory function of Treg cells, such as transendocytosis, and the control of adhesion and motility[1].

Verified Bioactivity

The ED50 as determined by its ability to bind Mouse B7-1 in functional ELISA is less than 20 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    P09793 (A37-D161)

  • Gene ID
    12477  [NCBI]
  • Molecular Construction
    • N-term
    • CTLA-4 (A37-D161)
      Accession # P09793
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CTLA4; Celiac Disease 3; Prev. CELIAC3; Cytotoxic T Lymphocyte Associated Antigen 4 Short Spliced Form; Prev. IDDM12; Cytotoxic T-Lymphocyte-Associated Serine Esterase-4; CTLA-4; Cytotoxic T-Lymphocyte-Associated Protein 4; CD152; Cytotoxic T-Lymphocyte A

  • AA Sequence

    AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

  • Predicted Molecular Mass

    14.6 kDa

  • Molecular Weight

    Approximately 17-30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

References

[1]. Behzad Rowshanravan, et al. CTLA-4: a moving target in immunotherapy. Blood. 2018 Jan 4;131(1):58-67. [Content Brief]

[2]. Noriko Mitsuiki, et al. What did we learn from CTLA-4 insufficiency on the human immune system?Immunol Rev. 2019 Jan;287(1):33-49. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CTLA-4 Protein, Mouse (HEK293, His) Product Image
    1/16
  • CTLA-4 Protein, Mouse (HEK293, His) Product Image