CXADR Protein, Human (HEK293, His)
Based on 1 Customer Validation
CXADR proteins are components of the epithelial apical junction complex and, as cell adhesion molecules, are critical for the integrity of tight junctions. CXADR Protein, Human (HEK293, His) is the recombinant human-derived CXADR protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CXADR proteins are components of the epithelial apical junction complex and, as cell adhesion molecules, are critical for the integrity of tight junctions. CXADR Protein, Human (HEK293, His) is the recombinant human-derived CXADR protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CXADR protein plays a pivotal role as a component of the epithelial apical junction complex, essential for maintaining tight junction integrity by functioning as a homophilic cell adhesion molecule. Beyond its structural role, CXADR is actively involved in facilitating the transepithelial migration of leukocytes through adhesive interactions with JAML, a transmembrane protein on the plasma membrane of leukocytes. This interaction not only supports the physical process of leukocyte migration but also serves as a key mediator for the activation of gamma-delta T-cells, a specialized T-cell subpopulation residing in epithelial tissues crucial for tissue homeostasis and repair. Upon binding to CXADR, JAML initiates downstream cell signaling events in gamma-delta T-cells, involving PI3-kinase and MAP kinases, leading to T-cell proliferation and the production of cytokines and growth factors. This cascade of events contributes to the stimulation of epithelial tissue repair. Notably, in the context of microbial infection, CXADR acts as a receptor for adenovirus type C.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P78310/NP_001329.1 (L20-G237)
-
Molecular Construction
-
N-term
-
CXADR (L20-G237)
Accession # P78310 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CXADR; CVB3-Binding Protein; CXADR Cell Adhesion Molecule; HCVADR; CAR; HCAR; Coxsackie Virus And Adenovirus Receptor; 46 KD Coxsackievirus And Adenovirus Receptor (CAR) Protein; Coxsackievirus And Adenovirus Receptor; CXADR, Ig-Like Cell Adhesion Molecul
-
AA Sequence
LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG
-
Predicted Molecular Mass
25.1 kDa
-
Molecular Weight
Approximately 32-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2. (Due to the optimization of production process, the components of different batches may vary slightly.)
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)