CXADR Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CXADR proteins are components of the epithelial apical junction complex and, as cell adhesion molecules, are critical for the integrity of tight junctions. CXADR Protein, Human (HEK293, His) is the recombinant human-derived CXADR protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CXADR proteins are components of the epithelial apical junction complex and, as cell adhesion molecules, are critical for the integrity of tight junctions. CXADR Protein, Human (HEK293, His) is the recombinant human-derived CXADR protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CXADR protein plays a pivotal role as a component of the epithelial apical junction complex, essential for maintaining tight junction integrity by functioning as a homophilic cell adhesion molecule. Beyond its structural role, CXADR is actively involved in facilitating the transepithelial migration of leukocytes through adhesive interactions with JAML, a transmembrane protein on the plasma membrane of leukocytes. This interaction not only supports the physical process of leukocyte migration but also serves as a key mediator for the activation of gamma-delta T-cells, a specialized T-cell subpopulation residing in epithelial tissues crucial for tissue homeostasis and repair. Upon binding to CXADR, JAML initiates downstream cell signaling events in gamma-delta T-cells, involving PI3-kinase and MAP kinases, leading to T-cell proliferation and the production of cytokines and growth factors. This cascade of events contributes to the stimulation of epithelial tissue repair. Notably, in the context of microbial infection, CXADR acts as a receptor for adenovirus type C.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CXADR (L20-G237)
      Accession # P78310
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CXADR; CVB3-Binding Protein; CXADR Cell Adhesion Molecule; HCVADR; CAR; HCAR; Coxsackie Virus And Adenovirus Receptor; 46 KD Coxsackievirus And Adenovirus Receptor (CAR) Protein; Coxsackievirus And Adenovirus Receptor; CXADR, Ig-Like Cell Adhesion Molecul

  • AA Sequence

    LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG

  • Predicted Molecular Mass

    25.1 kDa

  • Molecular Weight

    Approximately 32-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2. (Due to the optimization of production process, the components of different batches may vary slightly.)

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00