CXCL10 Protein, Rhesus macaque (His)

CXCL10 protein acts as a chemotactic factor for monocytes and T-lymphocytes, playing a crucial role in their migration in response to inflammatory signals. Through binding to CXCR3, CXCL10 selectively attracts monocytes and T-lymphocytes, positioning it as a key player in immune responses, contributing to the recruitment and activation of these immune cells in various physiological and pathological contexts. CXCL10 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CXCL10 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CXCL10 Protein, Rhesus macaque (His) is 77 a.a., with molecular weight of ~11 kDa.

CXCL10 protein serves as a chemotactic factor for both monocytes and T-lymphocytes, playing a crucial role in orchestrating their migration in response to inflammatory signals. Through its binding to CXCR3, CXCL10 establishes a molecular interaction that facilitates its chemoattraction functions. This selective chemotaxis for monocytes and T-lymphocytes positions CXCL10 as a key player in the immune response, contributing to the recruitment and activation of these immune cells within various physiological and pathological contexts.

Measured in a cytotoxicity assay using HUVEC Human Umbilical Vein Endothelial Cells. The ED₅₀ for this effect is 42.55 pg/mL, corresponding to a specific activity is 2.350×10⁷ units/mg.

• 
  Measured in a cytotoxicity assay using HUVEC Human Umbilical Vein Endothelial Cells. The ED₅₀ for this effect is 42.55 pg/mL, corresponding to a specific activity is 2.350×10⁷ units/mg.

Rhesus Macaque

E. coli

N-6*His

Q8MIZ1 (I22-P98)

574243  [NCBI]

IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Approximately 11 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.