IP-10/CXCL10 Protein, Rhesus macaque (His)
Based on 1 Customer Validation
CXCL10 protein acts as a chemotactic factor for monocytes and T-lymphocytes, playing a crucial role in their migration in response to inflammatory signals. Through binding to CXCR3, CXCL10 selectively attracts monocytes and T-lymphocytes, positioning it as a key player in immune responses, contributing to the recruitment and activation of these immune cells in various physiological and pathological contexts. IP-10/CXCL10 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CXCL10 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Rhesus Macaque
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CXCL10 protein acts as a chemotactic factor for monocytes and T-lymphocytes, playing a crucial role in their migration in response to inflammatory signals. Through binding to CXCR3, CXCL10 selectively attracts monocytes and T-lymphocytes, positioning it as a key player in immune responses, contributing to the recruitment and activation of these immune cells in various physiological and pathological contexts. IP-10/CXCL10 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CXCL10 protein, expressed by E. coli , with N-6*His labeled tag.
Background
CXCL10 protein serves as a chemotactic factor for both monocytes and T-lymphocytes, playing a crucial role in orchestrating their migration in response to inflammatory signals. Through its binding to CXCR3, CXCL10 establishes a molecular interaction that facilitates its chemoattraction functions. This selective chemotaxis for monocytes and T-lymphocytes positions CXCL10 as a key player in the immune response, contributing to the recruitment and activation of these immune cells within various physiological and pathological contexts.
Verified Bioactivity
Measured in a cytotoxicity assay using HUVEC Human Umbilical Vein Endothelial Cells. The ED50 for this effect is 42.55 pg/mL, corresponding to a specific activity is 2.350×107 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rhesus Macaque
-
Source E. coli
-
Tag N-6*His
-
Accession
Q8MIZ1 (I22-P98)
-
Molecular Construction
-
N-term
-
6*His
-
CXCL10 (I22-P98)
Accession # Q8MIZ1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL10; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member 10; Prev. SCYB10; Small-Inducible Cytokine B10; Prev. INP10; C-X-C Motif Chemokine 10; IP-10; Protein 10 From Interferon (Gamma)-Induced Cell Line; GIP-10; Interferon-Inducible Cytokine IP-1
-
AA Sequence
IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
-
Predicted Molecular Mass
8.7 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
