Copy Link Print Information

Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc)

Customer Review

Based on 1 Customer Validation

Ephrin-B1/EFNB1 Protein, a type I membrane protein, acts as a ligand for Eph-related receptor tyrosine kinases, potentially influencing cell adhesion and contributing to nervous system development. With ubiquitous expression, it is notably present in fat, placenta, and various tissues, showcasing its broad impact on diverse cellular and physiological contexts. Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc) is the recombinant human-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc)
  • Experimental Validation Results for Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc)
  • Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Ephrin-B1/EFNB1 Protein, a type I membrane protein, acts as a ligand for Eph-related receptor tyrosine kinases, potentially influencing cell adhesion and contributing to nervous system development. With ubiquitous expression, it is notably present in fat, placenta, and various tissues, showcasing its broad impact on diverse cellular and physiological contexts. Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc) is the recombinant human-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Ephrin-B1/EFNB1 Protein, a type I membrane protein, serves as a ligand for Eph-related receptor tyrosine kinases. Its involvement extends to potential roles in cell adhesion, contributing to the intricate processes of nervous system development or maintenance. Exhibiting ubiquitous expression, this protein is notably present in fat (RPKM 27.2), placenta (RPKM 17.2), and 23 other tissues, highlighting its wide-ranging influence across various cellular and physiological contexts.

Verified Bioactivity

Measured in a cell proliferation assay using HUVEC cells. The ED50 this effect is 2.876 ng/mL, corresponding to a specific activity is 3.4771×10^5 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HUVEC cells. The ED50 this effect is 2.876 ng/mL, corresponding to a specific activity is 3.4771×105 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    NP_004420.1 (L28-K237)

  • Gene ID
    1947  [NCBI]
  • Molecular Construction
    • N-term
    • EFNB1 (L28-K237)
      Accession # NP_004420.1
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    EFNB1; ELK Ligand; Prev. EPLG2; Craniofrontonasal Syndrome (Craniofrontonasal Dysplasia); Prev. CFNS; LERK-2; LERK2; ELK-L; EPH-Related Receptor Tyrosine Kinase Ligand 2; EFL-3; Ephrin-B1; CFND; Elk-L; EFB1; Ephrin B1; EFL3

  • AA Sequence

    LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSK

  • Predicted Molecular Mass

    49.1 kDa

  • Molecular Weight

    Approximately 59 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using HUVEC cells. The ED50 this effect is 2.876 ng/mL, corresponding to a specific activity is 3.4771×105 units/mg.

  • Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc) Product Image
    1/16
  • Experimental Validation Results for Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc)
  • Experimental Validation Results for Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc)
  • Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc) Product Image