FASLG Protein, Human (P. pastoris, His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals. FASLG Protein, Human (P. pastoris, His) is the recombinant human-derived FASLG protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of FASLG Protein, Human (P. pastoris, His) is 179 a.a., with molecular weight of 22.4 kDa.

FASLG protein, a cytokine, specifically binds to TNFRSF6/FAS, serving as a crucial mediator of apoptotic signals within cells. It plays integral roles in various cellular processes, including cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis, and T-cell development. FASLG is actively involved in initiating fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells, contributing to the controlled termination of immune responses. Additionally, TNFRSF6/FAS-mediated apoptosis, facilitated by FASLG, plays a role in the induction of peripheral tolerance. Notably, FASLG binds to TNFRSF6B/DcR3, a decoy receptor that functions to block apoptosis. Furthermore, FASLG has the capacity to induce FAS-mediated activation of NF-kappa-B, initiating non-apoptotic signaling pathways, and, while it can induce apoptosis, its essentiality for this process remains to be confirmed.

Human

P. pastoris

N-6*His

P48023 (Q103-L281)

356  [NCBI]

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

22.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.