Fas Ligand Protein, Human (P.pastoris, His)
FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals. Fas Ligand Protein, Human (P.pastoris, His) is the recombinant human-derived FASLG protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals. Fas Ligand Protein, Human (P.pastoris, His) is the recombinant human-derived FASLG protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
FASLG protein, a cytokine, specifically binds to TNFRSF6/FAS, serving as a crucial mediator of apoptotic signals within cells. It plays integral roles in various cellular processes, including cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis, and T-cell development. FASLG is actively involved in initiating fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells, contributing to the controlled termination of immune responses. Additionally, TNFRSF6/FAS-mediated apoptosis, facilitated by FASLG, plays a role in the induction of peripheral tolerance. Notably, FASLG binds to TNFRSF6B/DcR3, a decoy receptor that functions to block apoptosis. Furthermore, FASLG has the capacity to induce FAS-mediated activation of NF-kappa-B, initiating non-apoptotic signaling pathways, and, while it can induce apoptosis, its essentiality for this process remains to be confirmed.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P48023-1 (Q103-L281)
-
Molecular Construction
-
N-term
-
6*His
-
Fas Ligand (Q103-L281)
Accession # P48023-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FASLG; TNLG1A; Prev. APT1LG1; CD95L; Prev. TNFSF6; APTL; FasL; Tumor Necrosis Factor (Ligand) Superfamily, Member 6; Tumor Necrosis Factor Ligand Superfamily Member 6; Mutant Tumor Necrosis Factor Family Member 6; Fas Antigen Ligand; Apoptosis (APO-1) Ant
-
AA Sequence
QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
-
Predicted Molecular Mass
22.4 kDa
-
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
