1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Fc Receptors Biotinylated Proteins
  3. Inhibitory Checkpoint Molecules T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Fc-gamma Receptor
  4. FcγRIIIA/CD16a CD300a Fc gamma RIII/CD16
  5. Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi)

Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi)

Cat. No.: HY-P72885
Handling Instructions

Fc gamma RIIIA/CD16a Protein, a receptor for the Fc fragment of IgG, activates antibody-dependent cellular cytotoxicity (ADCC) upon binding antigen-IgG complexes. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells for efficient virus-infected cell elimination. Fc gamma RIIIA/CD16a regulates NK cell survival, proliferation, and prevents progenitor apoptosis. It forms signaling complexes, driving intracellular cascades for NK cell activation. The protein plays a crucial role in antitumor activities, triggering TNFA-dependent ADCC. In Dengue virus infection, it contributes to pathogenesis via antibody-dependent enhancement (ADE). Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-Avi, C-His labeled tag and F176V mutation. The total length of Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi) is 192 a.a., with molecular weight of ~46 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fc gamma RIIIA/CD16a Protein, a receptor for the Fc fragment of IgG, activates antibody-dependent cellular cytotoxicity (ADCC) upon binding antigen-IgG complexes. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells for efficient virus-infected cell elimination. Fc gamma RIIIA/CD16a regulates NK cell survival, proliferation, and prevents progenitor apoptosis. It forms signaling complexes, driving intracellular cascades for NK cell activation. The protein plays a crucial role in antitumor activities, triggering TNFA-dependent ADCC. In Dengue virus infection, it contributes to pathogenesis via antibody-dependent enhancement (ADE). Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-Avi, C-His labeled tag and F176V mutation. The total length of Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi) is 192 a.a., with molecular weight of ~46 kDa.

Background

Fc gamma RIIIA/CD16a Protein serves as a receptor for the invariable Fc fragment of immunoglobulin gamma (IgG), optimally activated upon binding clustered antigen-IgG complexes displayed on cell surfaces, initiating antibody-dependent cellular cytotoxicity (ADCC). This process involves the lysis of antibody-coated cells, preventing inappropriate effector cell activation in the absence of an antigenic trigger. The protein mediates IgG effector functions on natural killer (NK) cells, binding antigen-IgG complexes generated during infection to trigger NK cell-dependent cytokine production and degranulation. Fc gamma RIIIA/CD16a is crucial in generating memory-like adaptive NK cells that efficiently eliminate virus-infected cells via ADCC. It regulates NK cell survival, proliferation, and prevents NK cell progenitor apoptosis. As an Fc-binding subunit, it associates with CD247 and/or FCER1G adapters to form functional signaling complexes, leading to intracellular signaling cascades that drive NK cell activation. The protein also plays a role in mediating the antitumor activities of therapeutic antibodies, triggering TNFA-dependent ADCC of IgG-coated tumor cells and enhancing ADCC in response to afucosylated IgGs. In the context of Dengue virus infection, Fc gamma RIIIA/CD16a is involved in pathogenesis through an antibody-dependent enhancement (ADE) mechanism, facilitating virus entry into myeloid cells and subsequent viral replication during secondary infections.

Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

P08637 (G17-Q208, F176V)

Gene ID
Molecular Construction
N-term
CD16a (G17-Q208,
Accession # P08637
Avi-His
C-term
Synonyms
Low affinity immunoglobulin gamma Fc region receptor III-A; FcRIIIa; FcR-10; CD16a; FCGR3A; IGFR3
AA Sequence

MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

Molecular Weight

Approximately 46 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi)
Cat. No.:
HY-P72885
Quantity:
MCE Japan Authorized Agent: