1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Fc Receptors Biotinylated Proteins
  3. Inhibitory checkpoint molecules T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Fc-gamma Receptor
  4. FcγRIIIA/CD16a CD300a Fc gamma RIII/CD16
  5. Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi)

Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi)

Cat. No.: HY-P72885
Handling Instructions
Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi) at 10 μg/mL (100 μl/well) can bind human IgG1 and the EC50 is 0.08-0.18 μg/mL.
Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

P08637 (M1-Q208)

Gene ID
Synonyms
Low affinity immunoglobulin gamma Fc region receptor III-A; FcRIIIa; FcR-10; CD16a; FCGR3A; IGFR3
AA Sequence

MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

Molecular Weight

Approximately 46 kDa

Purity

Greater than 90 % as determined by SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi)
Cat. No.:
HY-P72885
Quantity:
MCE Japan Authorized Agent: