1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-2/bFGF
  6. FGF basic/bFGF Protein, Human (K128N)

FGF basic/bFGF Protein, Human (K128N)

Cat. No.: HY-P70600
COA Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $80 In-stock
Estimated Time of Arrival: December 31
50 μg $240 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

FGF basic/bFGF Protein, Human (K128N) Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE FGF basic/bFGF Protein, Human (K128N)

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P09038 (M1-S155)

Gene ID

2247  [NCBI]

Synonyms
Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2; FGF2; FGFB
AA Sequence

MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALNRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 200 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

FGF basic/bFGF Protein, Human (K128N) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF basic/bFGF Protein, Human (K128N)
Cat. No.:
HY-P70600
Quantity:
MCE Japan Authorized Agent: