FNDC4 Protein, Human (HEK293, Fc)

The FNDC4 protein is an anti-inflammatory factor in the intestine and colon that regulates macrophages by downregulating pro-inflammatory gene expression and affecting phagocytosis. It does this by modulating key pathways associated with macrophage activation, in part through STAT3 activation and signaling. FNDC4 Protein, Human (HEK293, Fc) is the recombinant human-derived FNDC4 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of FNDC4 Protein, Human (HEK293, Fc) is 123 a.a., with molecular weight of ~50-60 KDa.

FNDC4 protein functions as an anti-inflammatory factor in the intestine and colon, exerting its regulatory influence on macrophages. Through binding and interaction with macrophages, FNDC4 down-regulates the expression of pro-inflammatory genes, influencing essential macrophage functions such as phagocytosis. This anti-inflammatory effect is achieved by modulating key pathways associated with macrophage activation, in part through the activation and signaling of STAT3. The role of FNDC4 in dampening the immunological response, particularly in the context of colitis, underscores its potential significance as a molecular mediator in maintaining intestinal immune homeostasis.

Measured in a cell proliferation assay using U87 cells. The ED₅₀ for this effect is 63 ng/mL. Corresponding to a specific activity is 1.587×10⁴ unit/mg.

Human

HEK293

C-mFc

Q9H6D8/NP_073734.1 (D45-T167)

64838  [NCBI]

DRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQT

Approximately 50-60 kDa due to the glycosylation

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.