FNDC4 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
The FNDC4 protein is an anti-inflammatory factor in the intestine and colon that regulates macrophages by downregulating pro-inflammatory gene expression and affecting phagocytosis. It does this by modulating key pathways associated with macrophage activation, in part through STAT3 activation and signaling. FNDC4 Protein, Human (HEK293, Fc) is the recombinant human-derived FNDC4 protein, expressed by HEK293 , with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FNDC4 protein is an anti-inflammatory factor in the intestine and colon that regulates macrophages by downregulating pro-inflammatory gene expression and affecting phagocytosis. It does this by modulating key pathways associated with macrophage activation, in part through STAT3 activation and signaling. FNDC4 Protein, Human (HEK293, Fc) is the recombinant human-derived FNDC4 protein, expressed by HEK293 , with C-mFc labeled tag.
Background
FNDC4 protein functions as an anti-inflammatory factor in the intestine and colon, exerting its regulatory influence on macrophages. Through binding and interaction with macrophages, FNDC4 down-regulates the expression of pro-inflammatory genes, influencing essential macrophage functions such as phagocytosis. This anti-inflammatory effect is achieved by modulating key pathways associated with macrophage activation, in part through the activation and signaling of STAT3. The role of FNDC4 in dampening the immunological response, particularly in the context of colitis, underscores its potential significance as a molecular mediator in maintaining intestinal immune homeostasis.
Verified Bioactivity
Measured in a cell proliferation assay using U87 cells. The ED50 for this effect is 63 ng/mL. Corresponding to a specific activity is 1.587×104 unit/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
Q9H6D8/NP_073734.1 (D45-T167)
-
Molecular Construction
-
N-term
-
FNDC4 (D45-T167)
Accession # Q9H6D8/NP_073734.1 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FNDC4; Fibronectin Type III Domain-Containing Protein 4; Fibronectin Type III Domain Containing 4; Fibronectin Type III Repeat-Containing Protein 1; FRCP1; FLJ22362
-
AA Sequence
DRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQT
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
