GFRAL Protein, Human (His-SUMO)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (His-SUMO) is the recombinant human-derived GFRAL protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of GFRAL Protein, Human (His-SUMO) is 333 a.a., with molecular weight of ~53.8 kDa.

GFRAL Protein, a brainstem-restricted receptor for GDF15, plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Upon binding to its ligand, GDF15, GFRAL interacts with RET and activates cellular signaling through the MAPK- and AKT-signaling pathways. The receptor, through its extracellular domain, forms complexes with both GDF15 and RET, mediating cellular signaling specifically when RET is engaged after GDF15 binding. This intricate interaction highlights the sequential steps involving GFRAL, GDF15, and RET in the modulation of physiological responses to metabolic challenges.

Human

E. coli

N-His;N-SUMO

Q6UXV0 (S19-E351)

389400  [NCBI]

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Approximately 53.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.