1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Glucagon Receptor
  5. GLP-1 Receptor
  6. GLP1R Protein, Mouse (His-SUMO)

GLP1R protein, a G-protein coupled receptor, binds to GLP-1, activating adenylyl cyclase and increasing intracellular cAMP levels. This interaction regulates insulin secretion and maintains glucose homeostasis. GLP1R can also form dimers with GIPR, suggesting complex regulatory mechanisms and interactions with other receptors. GLP1R Protein, Mouse (His-SUMO) is the recombinant mouse-derived GLP1R protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

GLP1R protein, a G-protein coupled receptor, binds to GLP-1, activating adenylyl cyclase and increasing intracellular cAMP levels. This interaction regulates insulin secretion and maintains glucose homeostasis. GLP1R can also form dimers with GIPR, suggesting complex regulatory mechanisms and interactions with other receptors. GLP1R Protein, Mouse (His-SUMO) is the recombinant mouse-derived GLP1R protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

GLP1R, a G-protein coupled receptor, specifically binds to glucagon-like peptide 1 (GLP-1), initiating a signaling cascade that activates adenylyl cyclase, leading to elevated intracellular cAMP levels. This molecular interaction plays a pivotal role in the regulation of insulin secretion in response to GLP-1, contributing to glucose homeostasis. Furthermore, GLP1R exhibits the potential to form homodimers and heterodimers with the GIPR receptor, indicating possible complexities in its regulatory mechanisms and interplay with other receptors within the cellular context.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse GLP1R Protein at 2 μg/mL (100 μL/well) can bind Anti-GLP1R antibody. The ED50 for this effect is 155.0 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Mouse GLP1R Protein at 2 μg/mL (100 μL/well) can bind Anti-GLP1R antibody. The ED50 for this effect is 155.0 ng/mL.
Species

Mouse

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

O35659 (G22-Y145)

Gene ID
Molecular Construction
N-term
6*His-SUMO
GLP1R (G22-Y145)
Accession # O35659
C-term
Protein Length

Partial

Synonyms
Glp1r; Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R
AA Sequence

GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

분자량

Approximately 27-30 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

GLP1R Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

GLP1R Protein, Mouse (His-SUMO)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
GLP1R Protein, Mouse (His-SUMO)
Cat. No.:
HY-P72206
수량:
MCE Japan Authorized Agent: