GLP1R Protein, Mouse (His-SUMO)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

GLP1R protein, a G-protein coupled receptor, binds to GLP-1, activating adenylyl cyclase and increasing intracellular cAMP levels. This interaction regulates insulin secretion and maintains glucose homeostasis. GLP1R can also form dimers with GIPR, suggesting complex regulatory mechanisms and interactions with other receptors. GLP1R Protein, Mouse (His-SUMO) is the recombinant mouse-derived GLP1R protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

GLP1R protein, a G-protein coupled receptor, binds to GLP-1, activating adenylyl cyclase and increasing intracellular cAMP levels. This interaction regulates insulin secretion and maintains glucose homeostasis. GLP1R can also form dimers with GIPR, suggesting complex regulatory mechanisms and interactions with other receptors. GLP1R Protein, Mouse (His-SUMO) is the recombinant mouse-derived GLP1R protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

GLP1R, a G-protein coupled receptor, specifically binds to glucagon-like peptide 1 (GLP-1), initiating a signaling cascade that activates adenylyl cyclase, leading to elevated intracellular cAMP levels. This molecular interaction plays a pivotal role in the regulation of insulin secretion in response to GLP-1, contributing to glucose homeostasis. Furthermore, GLP1R exhibits the potential to form homodimers and heterodimers with the GIPR receptor, indicating possible complexities in its regulatory mechanisms and interplay with other receptors within the cellular context.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse GLP1R Protein at 2 μg/mL (100 μL/well) can bind Anti-GLP1R antibody. The ED50 for this effect is 155.0 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Mouse GLP1R Protein at 2 μg/mL (100 μL/well) can bind Anti-GLP1R antibody. The ED50 for this effect is 155.0 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • GLP1R (G22-Y145)
      Accession # O35659
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    GLP1R; GLP-1-R; Glucagon Like Peptide 1 Receptor; Seven Transmembrane Helix Receptor; Glucagon-Like Peptide 1 Receptor; GLP1 Receptor; GLP-1R; GLP-1; GLP-1 Receptor

  • AA Sequence

    GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

  • Molecular Weight

    Approximately 27-30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00