GLP1R Protein, Mouse (His-SUMO)

GLP1R protein, a G-protein coupled receptor, binds to GLP-1, activating adenylyl cyclase and increasing intracellular cAMP levels. This interaction regulates insulin secretion and maintains glucose homeostasis. GLP1R can also form dimers with GIPR, suggesting complex regulatory mechanisms and interactions with other receptors. GLP1R Protein, Mouse (His-SUMO) is the recombinant mouse-derived GLP1R protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of GLP1R Protein, Mouse (His-SUMO) is 124 a.a., with molecular weight of ~30.4 kDa.

GLP1R, a G-protein coupled receptor, specifically binds to glucagon-like peptide 1 (GLP-1), initiating a signaling cascade that activates adenylyl cyclase, leading to elevated intracellular cAMP levels. This molecular interaction plays a pivotal role in the regulation of insulin secretion in response to GLP-1, contributing to glucose homeostasis. Furthermore, GLP1R exhibits the potential to form homodimers and heterodimers with the GIPR receptor, indicating possible complexities in its regulatory mechanisms and interplay with other receptors within the cellular context.

Mouse

E. coli

N-6*His;N-SUMO

O35659 (G22-Y145)

14652  [NCBI]

GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

Approximately 30.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of Tris-based buffer, 50% Glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.