GMP SCF Protein, Human (HEK293, His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. GMP SCF Protein, Human (HEK293, His) is the recombinant human-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GMP SCF Protein, Human (HEK293, His) is 189 a.a., with molecular weight of 30-50 kDa.

The GMP stem cell factor (SCF) protein serves as a ligand for the receptor-type protein-tyrosine kinase KIT, playing a pivotal role in the regulation of diverse cellular processes. Its functions span the control of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon binding with KIT, GMP SCF activates multiple signaling pathways, including the phosphorylation of PIK3R1 and subsequent activation of the kinase AKT1. The interaction also triggers signaling cascades involving GRB2, RAS, RAF1, and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Furthermore, GMP SCF and KIT promote the activation of STAT family members (STAT1, STAT3, and STAT5), as well as PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Acting synergistically with other cytokines, likely interleukins, GMP SCF forms a homodimer non-covalently linked and a heterotetramer with KIT, facilitating KIT dimerization and subsequent activation through autophosphorylation.

Measured in a cell proliferation assay using TF-1 human erythroleukemic. The specific activity is > 5×10 ⁴ U/mg.

Human

HEK293

C-6*His

P21583 (E26-H214)

4254  [NCBI]

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

30-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.