1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GSTP1 Protein, Human (P.pastoris, His)

GSTP1 Protein, Human (P.pastoris, His)

Cat. No.: HY-P71740
Handling Instructions

The GSTP1 protein is critical for binding reduced glutathione to a variety of hydrophobic electrophiles, actively forming glutathione conjugates of PGA2 and PGJ2. Documented studies highlight its involvement in hepoxilin regioisomer synthesis, emphasizing the versatility of GSTP1 in processing substrates. GSTP1 Protein, Human (P.pastoris, His) is the recombinant human-derived GSTP1 protein, expressed by P. pastoris , with N-His labeled tag. The total length of GSTP1 Protein, Human (P.pastoris, His) is 209 a.a., with molecular weight of ~25.7 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GSTP1 protein is critical for binding reduced glutathione to a variety of hydrophobic electrophiles, actively forming glutathione conjugates of PGA2 and PGJ2. Documented studies highlight its involvement in hepoxilin regioisomer synthesis, emphasizing the versatility of GSTP1 in processing substrates. GSTP1 Protein, Human (P.pastoris, His) is the recombinant human-derived GSTP1 protein, expressed by P. pastoris , with N-His labeled tag. The total length of GSTP1 Protein, Human (P.pastoris, His) is 209 a.a., with molecular weight of ~25.7 kDa.

Background

The GSTP1 protein plays a crucial role in the cellular process of conjugating reduced glutathione to a diverse range of exogenous and endogenous hydrophobic electrophiles. Specifically, GSTP1 is actively involved in the formation of glutathione conjugates for prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2), as documented in studies. Furthermore, GSTP1 participates in the synthesis of novel hepoxilin regioisomers, underscoring its versatility in handling various substrates. Beyond its role in detoxification, GSTP1 negatively regulates CDK5 activity by facilitating the translocation of p25/p35, serving as a crucial mechanism to prevent neurodegeneration.

Species

Human

Source

P. pastoris

Tag

N-His

Accession

P09211 (P2-Q210)

Gene ID
Molecular Construction
N-term
His
GSTP1 (P2-Q210)
Accession # P09211
C-term
Synonyms
Deafness; Deafness X-linked 7; DFN7; FAEES3; GSTP; Gstp1; GSTP1-1; PI; X linked 7
AA Sequence

PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Molecular Weight

Approximately 25.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GSTP1 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GSTP1 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71740
Quantity:
MCE Japan Authorized Agent: