1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Macrophage CD Proteins Stem Cell CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. ICAM-1/CD54 Immunoglobulin-like Cell Adhesion Molecules
  5. Intercellular Adhesion Molecule 1 (ICAM-1)
  6. ICAM-1/CD54 Protein, Human (453a.a, HEK293, His)

ICAM-1/CD54 Protein, Human (453a.a, HEK293, His)

Cat. No.: HY-P72621
COA Handling Instructions

The ICAM-1/CD54 protein plays a crucial role in cell interactions, acting as a ligand for the leukocyte adhesion protein LFA-1. It promotes leukocyte transendothelial migration by promoting the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. ICAM-1/CD54 Protein, Human (453a.a, HEK293, His) is the recombinant human-derived ICAM-1/CD54 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ICAM-1/CD54 Protein, Human (453a.a, HEK293, His) is 453 a.a., with molecular weight of ~88 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $80 In-stock
50 μg $220 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ICAM-1/CD54 protein plays a crucial role in cell interactions, acting as a ligand for the leukocyte adhesion protein LFA-1. It promotes leukocyte transendothelial migration by promoting the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. ICAM-1/CD54 Protein, Human (453a.a, HEK293, His) is the recombinant human-derived ICAM-1/CD54 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ICAM-1/CD54 Protein, Human (453a.a, HEK293, His) is 453 a.a., with molecular weight of ~88 kDa.

Background

ICAM-1/CD54 protein emerges as a crucial player in cellular interactions, functioning as a ligand for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). Particularly notable is its role during leukocyte trans-endothelial migration, where engagement with ICAM-1 promotes the assembly of endothelial apical cups through the activation of ARHGEF26/SGEF and RHOG. In the context of microbial infection, ICAM-1 also acts as a receptor for major receptor group rhinovirus A-B capsid proteins, highlighting its versatile involvement in both immune responses and pathogen recognition. This dual functionality underscores the significance of ICAM-1 in mediating diverse cellular processes critical for immune regulation and host defense.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P05362 (Q28-E480)

Gene ID
Molecular Construction
N-term
ICAM-1 (Q28-E480)
Accession # P05362
6*His
C-term
Synonyms
Intercellular Adhesion Molecule 1; ICAM-1; Major Group Rhinovirus Receptor; CD54; ICAM1
AA Sequence

QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE

Molecular Weight

Approximately 88 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ICAM-1/CD54 Protein, Human (453a.a, HEK293, His)
Cat. No.:
HY-P72621
Quantity:
MCE Japan Authorized Agent: