IFN-alpha 2b/IFNA2 Protein, Human (His)

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection^[1]. IFN-alpha 2 increases the frequencies of cytotoxic CD8⁺ T cells and induces CD4⁺ T cell depletion^[3]. IFN-alpha 2b/IFNA2 Protein, Human contains 165 a.a., is produced in E. coli with N-6*His tagged.

IFN-alpha 2 (IFNA2; IFN-α2), belongs to the type I interferon family, produced by the plasmacytoid dendritic cells (pDCs) exposure to HIV-1BaL in order to inhibit viral infection^[1].
Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively^[2].
IFN-alpha 2 subtype is the only one that is currently licensed to treat infections caused by hepatitis B virus (HBV) and HCV^[3].
IFN-alpha 2 shows a Sortilin-dependent trafficking in cells and increases the expression level of interferon-stimulated genes (ISGs) in HIV-infected cells^[1][4].
IFN-alpha 2 increases the frequencies of cytotoxic CD8⁺ T cells and enhances CD4⁺ T cell depletion^[3].
Among the IFN-alpha 2 alleles, IFN-alpha 2b is being the predominant allele while IFNα-2a is less predominant and IFNα-2c only a minor allelic variant^[5].
IFN-alpha 2 has a bored application in research of cancer, including some hematological malignancies and solid tumors^[6]. As for a wildly use of IFN in animal disease model, the sequence of amino acids in IFNA2a protein of human is very different from mouse (59.57%).

IFNA2a (hydrodynamic injection with plasmids) leads to upregulation of interferon-stimulated genes (ISGs) and results HIV-1 induced CD4+ T cell depletion in the hu-PBL humanized mouse model^[3].

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ this effect is 0.1225 ng/mL, corresponding to a specific activity is 8.16×10⁶ units/mg.

Human

E. coli

N-6*His

P01563 (C24-E188)

3440  [NCBI]

Full Length of Mature Protein

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.