1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-lambda
  5. IFN-lambda 2/IL-28A
  6. IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His)

IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His)

Cat. No.: HY-P7991A
COA Handling Instructions

IFN-lambda 2/IL-28A protein is a cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in the antiviral defense of epithelial tissues by binding to IL10RB and IFNLR1 receptor complexes, activating the JAK/STAT signaling pathway. IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived IFN-lambda 2/IL-28A protein, expressed by HEK293 , with N-6*His labeled tag. The total length of IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His) is 174 a.a., with molecular weight of ~27 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $67 In-stock
50 μg $190 In-stock
100 μg $320 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-lambda 2/IL-28A protein is a cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in the antiviral defense of epithelial tissues by binding to IL10RB and IFNLR1 receptor complexes, activating the JAK/STAT signaling pathway. IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived IFN-lambda 2/IL-28A protein, expressed by HEK293 , with N-6*His labeled tag. The total length of IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His) is 174 a.a., with molecular weight of ~27 kDa.

Background

IFN-lambda 2/IL-28A Protein, a versatile cytokine, exhibits antiviral, antitumoral, and immunomodulatory activities, playing a crucial role in antiviral host defense, primarily within epithelial tissues. Functioning as a ligand for the heterodimeric class II cytokine receptor, consisting of IL10RB and IFNLR1, its receptor engagement initiates the JAK/STAT signaling pathway, resulting in the expression of IFN-stimulated genes (ISG) that establish an antiviral state. With a confined receptor distribution, it predominantly operates in epithelial cells due to the epithelial cell-specific expression of its receptor IFNLR1. While not deemed essential for early virus-activated host defense in vaginal infection, it assumes a significant role in Toll-like receptor (TLR)-induced antiviral defense and plays a crucial part in the antiviral immune defense in the intestinal epithelium. Additionally, IFN-lambda 2/IL-28A exerts an immunomodulatory effect by up-regulating MHC class I antigen expression, contributing to its impact on immune responses.

Biological Activity

Measured in a cell inhibitor assay using A549 cells. The ED50 for this effect is 2.972 ng/mL, corresponding to a specific activity is 3.365×105 units/mg.

  • Measured in a cell inhibitor assay using A549 cells. The ED50 for this effect is 2.972 ng/mL , corresponding to a specific activity is 3.365×105 units/mg.
Species

Mouse

Source

HEK293

Tag

N-6*His

Accession

Q4VK74 (D20-193V)

Gene ID

330496

Molecular Construction
N-term
6*His
IFN-λ2 (D20-193V)
Accession # Q4VK74
C-term
Synonyms
Interferon-λ2, IFN-λ2, IL-28A
AA Sequence

DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDLRCSSHLFPRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPRSPSRRLSRWLHRLQEAQSKETPGCLEASVTSNLFRLLTRDLKCVANGDQCV

Molecular Weight

Approximately 27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS, pH 7.4. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His)
Cat. No.:
HY-P7991A
Quantity:
MCE Japan Authorized Agent: