IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His)
Based on 1 Customer Validation
IFN-lambda 2/IL-28A protein is a cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in the antiviral defense of epithelial tissues by binding to IL10RB and IFNLR1 receptor complexes, activating the JAK/STAT signaling pathway. IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived IFN-lambda 2/IL-28A protein, expressed by HEK293 , with N-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IFN-lambda 2/IL-28A protein is a cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in the antiviral defense of epithelial tissues by binding to IL10RB and IFNLR1 receptor complexes, activating the JAK/STAT signaling pathway. IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived IFN-lambda 2/IL-28A protein, expressed by HEK293 , with N-6*His labeled tag.
Background
IFN-lambda 2/IL-28A Protein, a versatile cytokine, exhibits antiviral, antitumoral, and immunomodulatory activities, playing a crucial role in antiviral host defense, primarily within epithelial tissues. Functioning as a ligand for the heterodimeric class II cytokine receptor, consisting of IL10RB and IFNLR1, its receptor engagement initiates the JAK/STAT signaling pathway, resulting in the expression of IFN-stimulated genes (ISG) that establish an antiviral state. With a confined receptor distribution, it predominantly operates in epithelial cells due to the epithelial cell-specific expression of its receptor IFNLR1. While not deemed essential for early virus-activated host defense in vaginal infection, it assumes a significant role in Toll-like receptor (TLR)-induced antiviral defense and plays a crucial part in the antiviral immune defense in the intestinal epithelium. Additionally, IFN-lambda 2/IL-28A exerts an immunomodulatory effect by up-regulating MHC class I antigen expression, contributing to its impact on immune responses.
Verified Bioactivity
Measured in a cell inhibitor assay using A549 cells. The ED50 for this effect is 2.972 ng/mL, corresponding to a specific activity is 3.365×105 units/mg.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-6*His
-
Accession
Q4VK74 (D20-193V)
-
Gene ID330496
-
Molecular Construction
-
N-term
-
6*His
-
IFN-λ2 (D20-193V)
Accession # Q4VK74 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNL2; Interleukin-28A; Prev. IL28A; Interleukin 28A; IL-28A; ZCYTO20; Interleukin 28A (Interferon, Lambda 2); IFNL2a; Interferon Lambda-2; IFNL3a; Cytokine Zcyto20; Interferon Lambda 2; IFN-Lambda-2
-
AA Sequence
DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDLRCSSHLFPRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPRSPSRRLSRWLHRLQEAQSKETPGCLEASVTSNLFRLLTRDLKCVANGDQCV
-
Predicted Molecular Mass
19.7 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
