Inhibin alpha chain/INHA Protein, Bovine (His-SUMO)

Inhibin alpha chain/INHA protein plays a vital role in regulating pituitary function and contributes to the dual regulation of follicle-stimulating hormone secretion and activin. Inhibin alpha chain/INHA Protein, Bovine (His-SUMO) is the recombinant bovine-derived Inhibin alpha chain/INHA protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of Inhibin alpha chain/INHA Protein, Bovine (His-SUMO) is 134 a.a., with molecular weight of ~33 kDa.

Inhibin alpha chain/INHA protein takes center stage in the intricate regulation of pituitary gland function, participating in the dual modulation of follitropin secretion alongside activins. The broader influence of inhibins and activins, where Inhibin A is a key constituent, spans diverse physiological processes, including hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development, and bone growth, contingent upon their subunit composition. Notably, inhibins, represented by Inhibin A, emerge as apparent antagonists to the functions of activins within this multifaceted regulatory network. Structurally, Inhibin A exists as a dimer, intricately linked by one or more disulfide bonds, with its subunit composition comprising alpha and beta-A subunits. This dimeric configuration underscores the complexity of Inhibin A's role, shedding light on its involvement in the finely tuned orchestration of diverse physiological functions.

Bovine

E. coli

N-His;N-SUMO

P07994 (S227-I360)

281254  [NCBI]

STPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI

Approximately 33 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.