Copy Link Print Information

MMP-1 Protein, Human (HEK293, His, solution)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The MMP-1 protein acts as an enzyme capable of cleaving types I, II, and III collagen at specific sites within the helical domain. In addition, it exhibits lytic activity against type VII and type X collagen. MMP-1 Protein, Human (HEK293, His, solution) is the recombinant human-derived MMP-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for MMP-1 Protein, Human (HEK293, His, solution)
  • MMP-1 Protein, Human (HEK293, His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The MMP-1 protein acts as an enzyme capable of cleaving types I, II, and III collagen at specific sites within the helical domain. In addition, it exhibits lytic activity against type VII and type X collagen. MMP-1 Protein, Human (HEK293, His, solution) is the recombinant human-derived MMP-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Matrix metalloproteinase-1 (MMP-1) is a proteolytic enzyme known for its role in extracellular matrix remodeling. It exhibits a broad substrate specificity, cleaving collagens of types I, II, and III at a specific site within the helical domain. Additionally, MMP-1 demonstrates activity against collagens of types VII and X. Notably, in the context of HIV infection, MMP-1 interacts with and cleaves the secreted viral Tat protein, resulting in a decrease in neuronal Tat-mediated neurotoxicity. This interaction underscores the diverse functions of MMP-1 beyond its canonical role in extracellular matrix degradation, implicating it in processes associated with viral infection and neuroprotection (

Verified Bioactivity

Measured by its ability to cleave a fluorogenic peptide substrate Mca-KPLGL-Dpa-AR-NH2. Read at excitation and emission wavelengths of 360 nm and 405 nm. The specific activity is 4879.964 pmol/min/µg, as measured under the described conditions. (Activation description: The proenzyme needs to be activated by APMA (HY-148905) for an activated form.)

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Assay Procedure

Materials
Assay buffer: 50 mM Tris, 10 mM CaCl2, 150 mM NaCl, 0.05% (w/v) Brij-35, pH 7.5 (TCNB)
Test Protein: MMP-1 Protein, Human (HEK293, His, solution) (HY-P70250)
Activator: 4-Aminophenylmercuriacetic acid (APMA, HY-148905), dissolved in DMSO to 100 mM
Substrate: MCA-Lys-Pro-Leu-Gly-Leu-DPA-Ala-Arg-NH2< (HY-131498)
Standard: MCA-Pro-Leu-OH

Procedure
1. Standard curve: Dilute MCA-Pro-Leu-OH to concentrations of 0, 1.5625, 3.125, 6.25, 12.5, 25, 50, and 100 μmol/L using assay buffer. Add 100 μL of each dilution to black microplate wells. Read at 320 nm excitation and 405 nm emission (top read) in kinetic mode for 5 minutes. Plot the standard curve with measured RFU on the y-axis and standard substance amount on the x-axis to derive the standard curve equation.
2. Resuspend proteins in water to 200 μg/mL. Dilute Human MMP-1 to 50 μg/mL using assay buffer containing 1 mM APMA.
3. Activation: Incubate at 37°C for 2 hours.
4. Dilute the activated Human MMP-1 protein to 1 ng/μL using buffer.
5. Dilute the substrate to 20 μM using assay buffer.
6. Experimental group: 50 μL, 1 ng/μL Human MMP-1 protein + 50 μL, 20 μM substrate.
Control group: 50 μL, 20 μM substrate + 50 μL buffer.
7. Read for 5 minutes in kinetic mode at excitation and emission wavelengths of 320 nm and 405 nm respectively.
8. Calculate specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (RFU/min) x Conversion Factor ** (pmol/RFU)
amount of enzyme (μg)

*Adjusted for Substrate Blank
**Derived using calibration standard

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P03956 (F20-N469)

  • Gene ID
    4312  [NCBI]
  • Molecular Construction
    • N-term
    • MMP-1 (F20-N469)
      Accession # P03956
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein (with propeptide)

  • Synonyms

    MMP1; Matrix Metallopeptidase 1 (Interstitial Collagenase); Prev. CLG; Matrix Metalloproteinase 1; Interstitial Collagenase; Matrix Metalloprotease 1; Fibroblast Collagenase; Alternative Protein MMP1; Matrix Metalloproteinase 1 (Interstitial Collagenase); MMP-1; Matrix Metallopeptidase 1; Matrix Metalloproteinase-1

  • AA Sequence

    FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

  • Molecular Weight

    Approximately 55-57 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, 2 mM CaCl2, 1mM DTT, 0.05% Brij35, 10% glycerol, pH 5.0.
2.Supplied as a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, 2 mM CaCl2, 1 mM DTT, 0.05% Brij35, 10% glycerol, pH 5.0.
3.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
4.Supplied as a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, 2 mM CaCl2, 1 mM DTT, 10% glycerol, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • MMP-1 Protein, Human (HEK293, His, solution) Product Image
    1/16
  • Experimental Validation Results for MMP-1 Protein, Human (HEK293, His, solution)
  • MMP-1 Protein, Human (HEK293, His, solution) Product Image