1. Recombinant Proteins
  2. LD78-beta/CCL3L1 Protein, Human (HEK293 His)

LD78-beta/CCL3L1 Protein, Human (HEK293 His)

Cat. No.: HY-P7769
Handling Instructions

LD78-beta/CCL3L1 Protein, Human (HEK293 His) is a multiallelic copy number variable, which plays a crucial role in immunoregulatory and hosts defense through the production of macrophage inflammatory protein (MIP)-1α.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $165 Ask For Quote & Lead Time
50 μg $496 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuCCL3L1, His; C-C Motif Chemokine 3-Like 1; Small-Inducible Cytokine A3-Like 1; Tonsillar Lymphocyte LD78 Beta Protein; CCL3L1; D17S1718; G0S19-2; SCYA3L1; CCL3L3
Species

Human

Source

HEK 293

Accession

P16619 (A24-A93)

Gene ID

414062 6349

Molecular Weight

Approximately 16 kDa

AA Sequence

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAHHHHHH

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Among the reported genes with copy number variation (CNV), C Chemokine Ligand 3 Like 1 (CCL3L1) has been identified as one of the prominent genes with CNV in the current research field. CCL3L1 is clustered on chromosome 17q12. This gene showed involvement in segmental duplication which was enriched with the immune response gene. CCL3L1 encodes for LD78β, the isoforms of macrophage inflammatory protein 1α (MIP-1α) which only differs by three amino acids of the CCL3 mature protein (LD78α). The truncated-2 form of LD78β produced by CCL3L1 leads to high binding affinity to the CC chemokine receptor (CCR) 1 and 5[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LD78-beta/CCL3L1 Protein, Human (HEK293 His)
Cat. No.:
HY-P7769
Quantity:
MCE Japan Authorized Agent: