1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. LD78-beta/CCL3L1 Protein, Human (HEK293 His)

LD78-beta/CCL3L1 Protein, Human (HEK293 His)

Cat. No.: HY-P7769
Handling Instructions

LD78-beta/CCL3L1 Protein, Human (HEK293 His) is a multiallelic copy number variable, which plays a crucial role in immunoregulatory and hosts defense through the production of macrophage inflammatory protein (MIP)-1α.

For research use only. We do not sell to patients.

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

LD78-beta/CCL3L1 Protein, Human (HEK293 His) is a multiallelic copy number variable, which plays a crucial role in immunoregulatory and hosts defense through the production of macrophage inflammatory protein (MIP)-1α.

Background

Among the reported genes with copy number variation (CNV), C Chemokine Ligand 3 Like 1 (CCL3L1) has been identified as one of the prominent genes with CNV in the current research field. CCL3L1 is clustered on chromosome 17q12. This gene showed involvement in segmental duplication which was enriched with the immune response gene. CCL3L1 encodes for LD78β, the isoforms of macrophage inflammatory protein 1α (MIP-1α) which only differs by three amino acids of the CCL3 mature protein (LD78α). The truncated-2 form of LD78β produced by CCL3L1 leads to high binding affinity to the CC chemokine receptor (CCR) 1 and 5[1].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P16619 (A24-A93)

Gene ID

414062 6349

Synonyms
rHuCCL3L1, His; C-C Motif Chemokine 3-Like 1; Small-Inducible Cytokine A3-Like 1; Tonsillar Lymphocyte LD78 Beta Protein; CCL3L1; D17S1718; G0S19-2; SCYA3L1; CCL3L3
AA Sequence

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAHHHHHH

Molecular Weight

Approximately 16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

LD78-beta/CCL3L1 Protein, Human (HEK293 His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LD78-beta/CCL3L1 Protein, Human (HEK293 His)
Cat. No.:
HY-P7769
Quantity:
MCE Japan Authorized Agent: