1. Recombinant Proteins
  2. Receptor Proteins
  3. LDLR Protein, Human (Biotinylated, HEK293, Avi-His)

LDLR Protein, Human (Biotinylated, HEK293, Avi-His)

Cat. No.: HY-P72392
Handling Instructions

LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (Biotinylated, HEK293, Avi-His) is the recombinant human-derived LDLR protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of LDLR Protein, Human (Biotinylated, HEK293, Avi-His) is 767 a.a., with molecular weight of 95-140 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (Biotinylated, HEK293, Avi-His) is the recombinant human-derived LDLR protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of LDLR Protein, Human (Biotinylated, HEK293, Avi-His) is 767 a.a., with molecular weight of 95-140 kDa.

Background

The LDLR Protein serves as a crucial mediator in cholesterol homeostasis by binding to low-density lipoprotein (LDL), the primary cholesterol-carrying lipoprotein in plasma, and facilitating its cellular uptake through endocytosis. To enable internalization, receptor-ligand complexes must first cluster into clathrin-coated pits. Additionally, in the context of microbial infection, LDLR acts as a receptor for the hepatitis C virus within hepatocytes, although this interaction does not occur through a direct binding with viral proteins. This dual functionality underscores the diverse roles of LDLR in both cholesterol metabolism and the cellular response to viral infections.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

P01130 (A22-R788)

Gene ID
Molecular Construction
N-term
LDLR (A22-R788)
Accession # P01130
Avi-6*His
C-term
Synonyms
Low-Density Lipoprotein Receptor; LDL Receptor; LDLR
AA Sequence

AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVR

Molecular Weight

95-140 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LDLR Protein, Human (Biotinylated, HEK293, Avi-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LDLR Protein, Human (Biotinylated, HEK293, Avi-His)
Cat. No.:
HY-P72392
Quantity:
MCE Japan Authorized Agent: