NCL Protein, Human (P.pastoris, His)

Nucleolar protein (NCL) is the major nucleolar protein in actively growing eukaryotic cells and is associated with intranucleolar chromatin and preribosomal granules. It induces chromatin decondensation by binding to histone H1 and plays a role in pre-rRNA transcription, ribosome assembly, and potential transcription elongation. NCL Protein, Human (P.pastoris, His) is the recombinant human-derived NCL protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of NCL Protein, Human (P.pastoris, His) is 481 a.a., with molecular weight (post-translational modification form) of ~72 KDa.

Nucleolin (NCL) serves as the major nucleolar protein in actively growing eukaryotic cells, associating with intranucleolar chromatin and pre-ribosomal particles. Its involvement in inducing chromatin decondensation is facilitated by binding to histone H1. Nucleolin is implicated in pre-rRNA transcription, ribosome assembly, and potentially plays a role in transcriptional elongation. It exhibits a higher affinity for RNA oligonucleotides containing 5'-UUAGGG-3' repeats compared to telomeric single-stranded DNA with 5'-TTAGGG-3' repeats. Additionally, NCL is identified in an IGF2BP1-dependent mRNP granule complex. It is part of the SWAP complex and a larger complex involving HTATSF1, CDK9, CCNT1, RNA polymerase II, SUPT5H, and Nucleolin. NCL engages in diverse interactions with proteins such as AICDA, APTX, C1QBP, ERBB4, FMR1, GZF1, NSUN2, NVL, SETX, TERT, WDR46, ZFP36, LRRC34, RRP1B, HNRNPU, RIOK1, ZBTB7B, MDK, and HDGF, highlighting its multifaceted roles in various cellular processes.

Human

P. pastoris

N-6*His

P19338 (V2-S482)

4691  [NCBI]

VKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWS

Approximately 72 kDa. The reducing (R) protein migrat es as 72 kDa in SDS-PAGE may be due to post-translational modification.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 or 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.