NCL Protein, Human (P.pastoris, His)
Based on 1 publication(s) in Google Scholar
Nucleolar protein (NCL) is the major nucleolar protein in actively growing eukaryotic cells and is associated with intranucleolar chromatin and preribosomal granules. It induces chromatin decondensation by binding to histone H1 and plays a role in pre-rRNA transcription, ribosome assembly, and potential transcription elongation. NCL Protein, Human (P.pastoris, His) is the recombinant human-derived NCL protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Nucleolar protein (NCL) is the major nucleolar protein in actively growing eukaryotic cells and is associated with intranucleolar chromatin and preribosomal granules. It induces chromatin decondensation by binding to histone H1 and plays a role in pre-rRNA transcription, ribosome assembly, and potential transcription elongation. NCL Protein, Human (P.pastoris, His) is the recombinant human-derived NCL protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
Nucleolin (NCL) serves as the major nucleolar protein in actively growing eukaryotic cells, associating with intranucleolar chromatin and pre-ribosomal particles. Its involvement in inducing chromatin decondensation is facilitated by binding to histone H1. Nucleolin is implicated in pre-rRNA transcription, ribosome assembly, and potentially plays a role in transcriptional elongation. It exhibits a higher affinity for RNA oligonucleotides containing 5'-UUAGGG-3' repeats compared to telomeric single-stranded DNA with 5'-TTAGGG-3' repeats. Additionally, NCL is identified in an IGF2BP1-dependent mRNP granule complex. It is part of the SWAP complex and a larger complex involving HTATSF1, CDK9, CCNT1, RNA polymerase II, SUPT5H, and Nucleolin. NCL engages in diverse interactions with proteins such as AICDA, APTX, C1QBP, ERBB4, FMR1, GZF1, NSUN2, NVL, SETX, TERT, WDR46, ZFP36, LRRC34, RRP1B, HNRNPU, RIOK1, ZBTB7B, MDK, and HDGF, highlighting its multifaceted roles in various cellular processes.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Ann Rheum Dis
Generation of cytotoxic aptamers specifically targeting fibroblast-like synoviocytes by CSCT-SELEX for treatment of rheumatoid arthritis. [Abstract]2024 Sep 4:ard-2024-225565. PMID: 39237134
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P19338 (V2-S482)
-
Molecular Construction
-
N-term
-
6*His
-
NCL (V2-S482)
Accession # P19338 -
C-term
-
-
Protein Length
Partial
-
Synonyms
NUCLEOLIN; Nsr1; Prev. NCL; Protein C23; Nucleolin; Nucleolin Multifunctional Protein; C23; FLJ45706; MS1116 ; Nucl
-
AA Sequence
VKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWS
-
Predicted Molecular Mass
54.4 kDa
-
Molecular Weight
Approximately 72 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm sterile filtered PBS, 6% Trehalose, pH 7.4 or 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
