Nicotinamide N-Methyltransferase/NNMT Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The nicotinamide N-methyltransferase (NNMT) protein catalyzes the methylation of nicotinamide using S-adenosyl-L-methionine to form N1-methylnicotinamide. NNMT affects pluripotent embryonic stem cell development and acts as a metabolic regulator, affecting adipose tissue energy expenditure, gluconeogenesis, and cholesterol biosynthesis. Nicotinamide N-Methyltransferase/NNMT Protein, Human (His) is the recombinant human-derived Nicotinamide N-Methyltransferase/NNMT protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The nicotinamide N-methyltransferase (NNMT) protein catalyzes the methylation of nicotinamide using S-adenosyl-L-methionine to form N1-methylnicotinamide. NNMT affects pluripotent embryonic stem cell development and acts as a metabolic regulator, affecting adipose tissue energy expenditure, gluconeogenesis, and cholesterol biosynthesis. Nicotinamide N-Methyltransferase/NNMT Protein, Human (His) is the recombinant human-derived Nicotinamide N-Methyltransferase/NNMT protein, expressed by E. coli , with C-His labeled tag.

Background

Nicotinamide N-Methyltransferase (NNMT) is responsible for catalyzing the N-methylation of nicotinamide, utilizing the universal methyl donor S-adenosyl-L-methionine to produce N1-methylnicotinamide and S-adenosyl-L-homocysteine, representing a prominent pathway for nicotinamide/vitamin B3 clearance. This enzymatic activity plays a central role in cellular methylation potential regulation by consuming S-adenosyl-L-methionine, thus limiting its availability for other methyltransferases. NNMT actively orchestrates genome-wide epigenetic and transcriptional changes through the hypomethylation of repressive chromatin marks, such as H3K27me3, and contributes to the establishment of low levels of repressive histone marks in pluripotent embryonic stem cell pre-implantation state during development. Functionally, NNMT acts as a metabolic regulator impacting white adipose tissue energy expenditure, hepatic gluconeogenesis, and cholesterol biosynthesis. In white adipocytes, it regulates polyamine flux and controls NAD(+) levels through the salvage pathway. Additionally, NNMT, by producing N1-methylnicotinamide, influences protein acetylation in hepatocytes, repressing the ubiquitination and enhancing the stability of the SIRT1 deacetylase. Furthermore, NNMT exhibits versatility by N-methylating other pyridines structurally related to nicotinamide, suggesting a role in xenobiotic detoxification.

Verified Bioactivity

1. Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 0.0488 μg/mL, corresponding to a specific activity is 2.049×104 units/mg.
2. Measured by its ability to methylate nicotinamide. The specific activity is 114.696 pmol/min/μg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 0.0488 μg/mL, corresponding to a specific activity is 2.049×104 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • NNMT (M1-L264)
      Accession # P40261
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    NNMT; NNMT Protein; Nicotinamide N-Methyltransferase

  • AA Sequence

    MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

  • Molecular Weight

    Approximately 25-29 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00