OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi)

OCIL/CLEC2D Protein, as a receptor for KLRB1, safeguards target cells from natural killer cell-mediated lysis. It not only inhibits osteoclast formation and bone resorption but also regulates interferon-gamma release, indicating its immune and bone-related regulatory functions. Additionally, OCIL/CLEC2D can bind high molecular weight sulfated glycosaminoglycans, suggesting its involvement in interactions with extracellular components. Existing as a homodimer with disulfide linkages, its oligomeric form plays a crucial role in mediating immune protection and bone homeostasis. OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) is the recombinant human-derived OCIL/CLEC2D protein, expressed by HEK293, with N-hFc, N-Avi labeled tag. The total length of OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) is 132 a.a., with molecular weight of 68-78 kDa.

OCIL/CLEC2D Protein serves as a receptor for KLRB1, providing protection to target cells against natural killer cell-mediated lysis. Not only does it inhibit osteoclast formation and bone resorption, but it also modulates the release of interferon-gamma, showcasing its regulatory role in immune responses and bone-related processes. Furthermore, OCIL/CLEC2D exhibits the ability to bind high molecular weight sulfated glycosaminoglycans, suggesting its involvement in interactions with extracellular components. Structurally, it exists as a homodimer with disulfide linkages, emphasizing the significance of its oligomeric form in mediating cellular functions associated with immune protection and bone homeostasis.

Human

HEK293

N-hFc;N-Avi

Q9UHP7-1 (R60-V191)

29121  [NCBI]

RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV

68-78 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.