Copy Link Print Information

OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi)

Customer Review

Based on 1 Customer Validation

The OCIL/CLEC2D protein acts as a receptor for KLRB1 and protects target cells from natural killer cell-mediated lysis. It not only inhibits osteoclast formation and bone resorption, but also regulates the release of interferon-γ, indicating that it has immune and bone-related regulatory functions. OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) is the recombinant human-derived OCIL/CLEC2D protein, expressed by HEK293 , with N-hFc, N-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The OCIL/CLEC2D protein acts as a receptor for KLRB1 and protects target cells from natural killer cell-mediated lysis. It not only inhibits osteoclast formation and bone resorption, but also regulates the release of interferon-γ, indicating that it has immune and bone-related regulatory functions. OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) is the recombinant human-derived OCIL/CLEC2D protein, expressed by HEK293 , with N-hFc, N-Avi labeled tag.

Background

OCIL/CLEC2D Protein serves as a receptor for KLRB1, providing protection to target cells against natural killer cell-mediated lysis. Not only does it inhibit osteoclast formation and bone resorption, but it also modulates the release of interferon-gamma, showcasing its regulatory role in immune responses and bone-related processes. Furthermore, OCIL/CLEC2D exhibits the ability to bind high molecular weight sulfated glycosaminoglycans, suggesting its involvement in interactions with extracellular components. Structurally, it exists as a homodimer with disulfide linkages, emphasizing the significance of its oligomeric form in mediating cellular functions associated with immune protection and bone homeostasis.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc;N-Avi
  • Accession

    Q9UHP7-1 (R60-V191)

  • Gene ID
    29121  [NCBI]
  • Molecular Construction
    • N-term
    • hFc-Avi
    • CLEC2D (R60-V191)
      Accession # Q9UHP7-1
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLEC2D; C-Type Lectin Domain Family 2 Member D Isoform 11; C-Type Lectin Domain Family 2 Member D; C-Type Lectin Domain Family 2 Member D Isoform 12; LLT1; C-Type Lectin Domain Family 2 Member D Variant 2; CLAX; C-Type Lectin Domain Family 2 Member D Vari

  • AA Sequence

    RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV

  • Predicted Molecular Mass

    59.1 kDa

  • Molecular Weight

    Approximately 72-78 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) Product Image
    1/16
  • OCIL/CLEC2D Protein, Human (HEK293, Fc-Avi) Product Image