OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc)
OX40 Ligand/TNFSF4 Protein, a cytokine, binds TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. As a homotrimer, its pivotal interaction with TNFRSF4 enhances immune response by activating and expanding T-cells. This engagement contributes to intricate regulation, making OX40 Ligand a key mediator in modulating T-cell functions for effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc) is the recombinant Rabbit-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rabbit
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
OX40 Ligand/TNFSF4 Protein, a cytokine, binds TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. As a homotrimer, its pivotal interaction with TNFRSF4 enhances immune response by activating and expanding T-cells. This engagement contributes to intricate regulation, making OX40 Ligand a key mediator in modulating T-cell functions for effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc) is the recombinant Rabbit-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The OX40 Ligand/TNFSF4 Protein, a cytokine, binds specifically to TNFRSF4, exerting its role as a potent co-stimulator for T-cell proliferation and cytokine production. Operating as a homotrimer, its interaction with TNFRSF4 plays a pivotal role in enhancing the immune response by promoting the activation and expansion of T-cells. Through this engagement, OX40 Ligand contributes to the intricate regulation of T-cell-mediated immune responses, serving as a key mediator in modulating T-cell functions for effective and controlled immune activation.
Technical Parameters
-
Species Rabbit
-
Source HEK293
-
Tag C-hFc
-
Accession
O02765 (Q45-P187)
-
Molecular Construction
-
N-term
-
OX40L (Q45-P187)
Accession # O02765 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFSF4; Tumor Necrosis Factor (Ligand) Superfamily Member 4; Prev. TXGP1; Tumor Necrosis Factor Superfamily Member 4; Tumor Necrosis Factor Ligand Superfamily Member 4; Tumor Necrosis Factor Ligand 2B; OX-40L; OX40 Antigen Ligand; CD252; CD252 Antigen; Gp
-
AA Sequence
QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP
-
Predicted Molecular Mass
44.9 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
