OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc)

OX40 Ligand/TNFSF4 Protein, a cytokine, binds TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. As a homotrimer, its pivotal interaction with TNFRSF4 enhances immune response by activating and expanding T-cells. This engagement contributes to intricate regulation, making OX40 Ligand a key mediator in modulating T-cell functions for effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc) is the recombinant Rabbit-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Rabbit
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

OX40 Ligand/TNFSF4 Protein, a cytokine, binds TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. As a homotrimer, its pivotal interaction with TNFRSF4 enhances immune response by activating and expanding T-cells. This engagement contributes to intricate regulation, making OX40 Ligand a key mediator in modulating T-cell functions for effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc) is the recombinant Rabbit-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The OX40 Ligand/TNFSF4 Protein, a cytokine, binds specifically to TNFRSF4, exerting its role as a potent co-stimulator for T-cell proliferation and cytokine production. Operating as a homotrimer, its interaction with TNFRSF4 plays a pivotal role in enhancing the immune response by promoting the activation and expansion of T-cells. Through this engagement, OX40 Ligand contributes to the intricate regulation of T-cell-mediated immune responses, serving as a key mediator in modulating T-cell functions for effective and controlled immune activation.

Technical Parameters

  • Species Rabbit
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • OX40L (Q45-P187)
      Accession # O02765
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TNFSF4; Tumor Necrosis Factor (Ligand) Superfamily Member 4; Prev. TXGP1; Tumor Necrosis Factor Superfamily Member 4; Tumor Necrosis Factor Ligand Superfamily Member 4; Tumor Necrosis Factor Ligand 2B; OX-40L; OX40 Antigen Ligand; CD252; CD252 Antigen; Gp

  • AA Sequence

    QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP

  • Predicted Molecular Mass

    44.9 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00