PD-L1 Protein, Rat (221a.a, HEK293, His)

PD-L1 Protein is a type I transmembrane protein that belongs to the immunoglobulin (Ig) superfamily. PD-L1 can interact with PD-1, and PD-1/PD-L1 axis is responsible for T cell activation, proliferation, and cytotoxic secretion in cancer, and regulates anti-tumor immune responses. PD-L1 plays a major role in suppressing the adaptive arm of immune systems^[1][2][3]. PD-L1 Protein, Rat (221a.a, HEK293, His) is the recombinant rat-derived PD-L1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PD-L1 Protein, Rat (221a.a, HEK293, His) is 221 a.a., with molecular weight of 40-60 kDa.

PD-L1 (CD274) is a type I transmembrane protein that belongs to the immunoglobulin (Ig) superfamily. PD-1 can interact with its ligands PD-L1 or PD-L2. PD-1/PD-L1 axis is responsible for T cell activation, proliferation, and cytotoxic secretion in cancer, and regulates anti-tumor immune responses^[1]. In addition, PD-L1 can also interact with CD80, which may deliver inhibitory signals to activated T cells. In the abscence of PD-1 signaling in T cells, PD-L1 is also able to protect tumor cells from the cytotoxic effects of type I and type II interferons and from cytotoxic T lymphocyte (CTL)-mediated cytolysis^[2].
PD-L1 can promote differentiation and maintain the function of induced T reg (iT reg) cells by sustaining and enhancing Foxp3 expression in iT reg cells. PD-L1 induces iT reg cells by inhibiting the Akt/mTOR signaling cascade^[3].
PD-L1 is often expressed by macrophages, some activated T cells and B cells, DCs and some epithelial cells, especially under inflammatory conditions. Noticeably, PD-L1 is expressed by tumor cells as an “adaptive immune mechanism” to escape anti-tumor responses. Therefore, PD-L1 acts as a pro-tumorigenic factor in cancer cells via binding to its receptors^[1].

Rat

HEK293

C-6*His

D4AE25 (A18-T238)

499342  [NCBI]

AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT

40-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.